KEGG   Synechococcus elongatus PCC6301: syc1769_d
Entry
syc1769_d         CDS       T00163                                 

Gene name
opcA
Definition
(GenBank) glucose 6-phosphate dehydrogenase assembly protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: OpcA_G6PD_assem PG_binding_1 Met_gamma_lyase
Other DBs
NCBI-ProteinID: BAD79959
CyanoBase: syc1769_d
CYORF: syc1769_d
UniProt: A0A0H3K4F7
Position
1915728..1917065
AA seq 445 aa
MTTATPLLSLQKPTPIALAEIEESLSQLWANQQHSGAGALVSRAATFSIVVYEPEEFQQI
LAALGLYHGHLDGLHGPMTRAAIAQAQTQFGLPSTGRPDSATFKALRQAYQALKHSPSLT
NQDLRGAVLSNVIATQNPCRIVSLCPTLEGDRPISAEVSAYCPITSAKQASLICCEAVTL
RGSQAEMEAIGTFVSELLLPGLPRYVWWKATPNPEQLLFQQLANSCNCMIFDSSYFSDPE
AEFLRFQDLIDQETYIADLNWHRLAAWQELTAAAFDPPERRDGLLEVDQLVIDYEKGNPA
QALMYMGWIASRLGWQPVSYRCEGGEYDLRQIEFRTEDDRMVKVELAGIPVGDPGLVLGD
LIALRLTSENPDADCCTILCSETTGCMRMEAGGGAQSCRTEQVAPPSNETSESLLAMQMQ
RWGRDALYEESLAVIAVALRQRTHA
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgacgaccgctactcccctcctttcgctccaaaaaccaacgccaatcgcgctggctgaa
attgaagaatccctcagtcagctctgggctaaccagcagcacagcggagcgggtgccttg
gtctcgcgggcggccaccttcagcatcgtggtctatgaacccgaggagttccaacagatt
ctggcggctctgggtctgtaccatgggcaccttgatggattgcatggtccgatgactcgc
gccgcgatcgcccaagcccagacacaattcgggctcccctcgacggggcgacctgacagc
gccaccttcaaagccctccggcaggcctaccaagccctgaagcactcgccaagcttgacc
aatcaggatctgcgcggtgcggtgctcagcaatgtgattgcgacgcagaacccctgtcgg
atcgtcagcctctgccccaccctcgagggtgatcgcccaattagtgctgaggtttcggcc
tactgtccgatcacttcagccaagcaggcttcactgatctgctgcgaagctgtcaccctg
cggggctcgcaggcagagatggaagcgatcggtacgtttgtcagcgagctattgctgcca
ggcttaccccgatatgtctggtggaaagcgacaccgaatcccgagcagttgctctttcag
cagttagccaattcttgcaactgcatgattttcgactcgtcctacttcagcgatcccgaa
gctgaatttctccgcttccaagatctaattgaccaagaaacctacatcgccgatctcaac
tggcaccgccttgcggcttggcaagaacttactgctgcggcctttgatccgccagagcgt
cgtgatgggttgctggaagtcgatcaactggtgatcgactacgaaaaaggtaatcccgcc
caagccttgatgtacatgggttggattgccagtcgcttgggttggcaaccggtgagttac
cgctgtgaaggcggtgaatacgatctccgccaaattgagttccggaccgaggatgatcgc
atggtcaaggtcgagttggcggggattcctgtcggcgatccgggtttagtcttgggtgat
ctgattgccctgcgcctgacgtccgaaaatcctgatgccgactgctgcacgattctctgt
tcggagacaacgggttgtatgcgaatggaggcaggtggtggtgctcaatcctgccgcacg
gagcaggtcgctccaccctctaacgaaacttcagaatcgctactggccatgcagatgcag
cgctggggacgagatgctctctacgaggaaagcctagcggtaattgcggtagcactccgg
caacgcacccacgcctaa

DBGET integrated database retrieval system