KEGG   Synechococcus elongatus PCC6301: syc1770_c
Entry
syc1770_c         CDS       T00163                                 

Gene name
petD
Definition
(GenBank) cytochrome b6-f complex subunit 4
  KO
K02637  cytochrome b6-f complex subunit 4
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00162  Cytochrome b6f complex
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1770_c (petD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1770_c (petD)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Cytochrome b6/f complex [OT]
   syc1770_c (petD)
SSDB
Motif
Pfam: Cytochrom_B_C
Other DBs
NCBI-ProteinID: BAD79960
CyanoBase: syc1770_c
CYORF: syc1770_c
UniProt: Q5N160
Position
complement(1917176..1917658)
AA seq 160 aa
MSILKKPDLSDPILRQKLAKGMGHNYYGEPAWPNDLLYMFPVVILGTIACLTGLAVLDPA
LVGEPADPFATPLEILPEWYLYPVFQILRIVPNKLLGIVLQSMIPLGLIAIPFIESVNKF
QNPFRRPIATAVFLFGTVFTLYLGIGAALPIDKSLTLGLF
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtccatcttgaagaagccggatcttagcgatccgattctgcgccaaaagctggccaaa
ggtatgggccataactactatggcgagcccgcttggcccaacgatttgctctacatgttc
ccagtggtgattctgggaacgatcgcctgcctgaccggcttggcagttctggatccagct
ttggtgggtgaaccggctgatcccttcgcgaccccgctggaaattctgccggagtggtac
ctctaccccgtcttccagatcctgcggatcgtcccgaataagctgctgggcatcgtcctg
cagtccatgattcctttgggcttgattgcaattccgttcatcgaaagcgtcaacaagttc
caaaatcctttccgtcgcccgatcgcaacggctgtcttcctgtttggtacggtctttacc
ctctacctcggaattggtgcagcgttaccgatcgataagtcgctgaccctcggcttgttc
taa

DBGET integrated database retrieval system