KEGG   Synechococcus elongatus PCC6301: syc1771_c
Entry
syc1771_c         CDS       T00163                                 

Gene name
petB
Definition
(GenBank) cytochrome b6
  KO
K02635  cytochrome b6
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
syc01100  Metabolic pathways
Module
syc_M00162  Cytochrome b6f complex
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1771_c (petB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1771_c (petB)
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Cytochrome b6/f complex [OT]
   syc1771_c (petB)
SSDB
Motif
Pfam: Cytochrome_B Cytochrom_B_N_2 DUF4405 Ni_hydr_CYTB DUF373
Other DBs
NCBI-ProteinID: BAD79961
CyanoBase: syc1771_c
CYORF: syc1771_c
UniProt: Q5N159
Position
complement(1917755..1918402)
AA seq 215 aa
MSKVYDWFEERLEIQAIAEDVSSKYVPPHVNIFYCLGGITLTCFLIQFATGFAMTFYYKP
TVAEAYSSVQFIMNQVNFGWLIRSIHRWSASMMVLMMILHVFRVYLTGGFKRPRELTWVT
GVVMAVITVTFGVTGYSLPWDQVGYWAVKIVSGVPEAIPVVGSAMVELLRGGQSVGQATL
TRFYSLHTFVLPWLIAVFMLLHFLMIRKQGISGPL
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtcgaaggtctacgactggttcgaggagcgtctagagatccaagcgatcgctgaagac
gtttccagcaagtacgttcctccccacgtcaacatcttctattgtctgggcgggattacg
ttaacttgttttctcattcagtttgccaccggctttgcaatgacgttttattacaagccg
acggttgctgaagcatatagctccgtgcaattcatcatgaaccaagtcaacttcggttgg
ctgatccgctccatccaccgctggtctgccagcatgatggtgctgatgatgattctgcac
gttttccgtgtttatctgactggtggtttcaaacgccctcgcgaattgacctgggtcact
ggcgtcgtcatggcagtgatcaccgtgaccttcggggtgaccggctactcgctgccttgg
gaccaagtcggctactgggccgtcaaaattgtctcgggtgttcccgaagcgattccggtg
gttgggtctgccatggttgaactactgcggggcggccaaagcgtcggtcaggcaactctg
acccgcttctacagcctccacacctttgtcttgccttggctgattgcagtgtttatgctg
cttcacttcctgatgatccggaagcaaggcatctctggtcccctctaa

DBGET integrated database retrieval system