KEGG   Synechococcus elongatus PCC6301: syc1772_d
Entry
syc1772_d         CDS       T00163                                 

Gene name
ctpA
Definition
(GenBank) carboxyl-terminal processing protease
  KO
K03797  carboxyl-terminal processing protease [EC:3.4.21.102]
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:syc01002]
    syc1772_d (ctpA)
Enzymes [BR:syc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.102  C-terminal processing peptidase
     syc1772_d (ctpA)
Peptidases and inhibitors [BR:syc01002]
 Serine peptidases
  Family S41: C-terminal processing peptidase family
   syc1772_d (ctpA)
SSDB
Motif
Pfam: Peptidase_S41 PDZ_6 PDZ_2 PDZ Tricorn_C1
Other DBs
NCBI-ProteinID: BAD79962
CyanoBase: syc1772_d
CYORF: syc1772_d
UniProt: A0A0H3KAS9
Position
1918613..1919836
AA seq 407 aa
MIQPFLKRSLLWLTLLFWFATATPALALTEEQKLFNEAWRIVNQSYVDPSFNHSNWFQLR
EKILKKPLDNRDQTYTAIEGLLAKLDDPFTRLLRPDQYRNLQVSTAGELSGVGLQIGFEA
ESGDVVVIAPIEGSPAALAGLLSGDRILTVDGVAISGRDLDEAAARMRGPRGTTVALQVL
RDQQTLDFELVRDRISLNPVRSQLDRDGDHPPIGYIRLSQFNANASVEVAHAIAQLDQQG
AEAFVLDLRNNSGGLLTAGIEIAREWLNEGAIVYTVNRQGVLDSFAANGQALTDKPLALL
VNRGTASASEILAGALQDNERAILVGDRTFGKGLIQSLFELSDGAGLAVTVAEYETPNHN
DINKQGIQPDLAVEQSEPLFAEAIASAAVRQYQAAVTALTEQVRHRA
NT seq 1224 nt   +upstreamnt  +downstreamnt
atgatccagccatttctgaagcgatcgctcctttggctcacgctgttgttctggtttgcg
acagcgacgccggcgttggccctgacggaagagcagaaactgttcaatgaggcctggcgc
attgtcaaccagtcctacgtcgatcccagctttaaccacagcaactggttccagttgcgc
gagaagattctgaaaaagccgctggacaatcgggatcagacctacaccgcgatcgaaggt
ttgctagccaaactagatgacccatttacgcggttgctacggccagatcaatatcgcaac
ctccaagtctcgacggccggtgagctatcgggcgtcggtttgcagattggctttgaggcc
gaaagtggcgatgtggtggtgattgccccgatcgaaggttcgccggcagccctggcgggt
ctgctgtcgggcgatcgcatcctgacggtggatggggtggcgatttccggtcgagatctg
gatgaagcggcggctcggatgcgcggacctcgcgggacgacggtggcgctccaagtcctg
cgcgatcaacaaaccttggattttgaactagttcgcgatcgcatcagtctcaaccccgtg
cgatcgcagctggatcgcgatggcgatcatccaccgattggctacattcgcctcagccaa
tttaatgccaatgcctcggtagaagtggctcatgcgatcgcccaactcgatcagcaggga
gccgaagccttcgtccttgatttgcgcaataactcaggcggactgctgaccgctggcatc
gagattgcgcgggaatggctgaacgaaggcgcgatcgtctacaccgtcaatcgtcagggg
gtgctggatagctttgcggcaaatggccaagcgctgacggataaacccttggcactcctc
gtcaatcgcggcactgctagcgccagcgaaattctagccggcgcactacaagacaatgaa
cgcgccattttggtgggcgatcgcacctttggcaaaggtttgattcagtcgctgttcgaa
ctgtcggatggggcgggtttggcggtcactgtcgccgaatacgaaacgcccaaccacaac
gacatcaataagcagggcattcagcccgatctcgcagttgaacagtctgaaccgctgttt
gcggaggcgattgcttccgctgccgttcgccaatatcaggcagcggtaacggcgctgaca
gagcaagtgaggcatcgtgcctag

DBGET integrated database retrieval system