KEGG   Synechococcus elongatus PCC6301: syc1773_d
Entry
syc1773_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K06885  uncharacterized protein
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    syc1773_d
SSDB
Motif
Pfam: HD PDEase_I
Other DBs
NCBI-ProteinID: BAD79963
CyanoBase: syc1773_d
CYORF: syc1773_d
UniProt: A0A0H3K3Q5
Position
1919829..1921103
AA seq 424 aa
MPSRRQRIYHDPLHGAIALQFEDPLEATLIRLIDTPPFQRLRRTCQLGPASLTFHGAEAS
RFTHSLGVMQVARRAFAPIAADWPELAVHRPALLCAALLHDLGHTAFSHTGEEIFHCQHE
QWTARLITEDSPIRRVLADYDPALPEQVLAVYRKQYQPLLISRLITSQLDCDRLDYLLRD
SYFTGASYGRLDLDRILSALRFDSESGELAVAEKGLAAIEHYLVVRSFMYSQVYNHPKNI
VAGWMLVRIFERARQLWQEQPRSLFVDPLLQPWFEQPVTDLSLEEYLAVDDIVCLYHLQR
WQDSADPLLADLCRRYRDRDLLKALNLRNLPAEQQQTLLEHSQQLIRNQGQDPTGYTGLC
QTQSRGYTLYQSGIRLATDQGLLEISQRSPLIRALLEPPSQAWLIYPRVIEQPLKQQWQL
VRGS
NT seq 1275 nt   +upstreamnt  +downstreamnt
gtgcctagtcgccgccagcgcatctaccacgatccactccacggggcgatcgccctgcaa
tttgaagacccgctggaagcaacgctgatccgcttgatcgatacgccaccctttcagcgg
ctacggcggacctgccagcttggtcccgccagtttgacctttcatggagctgaagcctct
cgcttcacccattccctcggggtgatgcaggttgctcgccgtgcctttgccccgatcgca
gctgattggcccgaattggcagtgcatcgaccggcgttgctctgtgcggcactgctacat
gacttaggccatacggcctttagccacaccggcgaggagattttccactgccaacatgag
cagtggacagcccggctaatcactgaggactctccgattcggcgggtgctagccgattac
gatccggcgctgccggagcaagttcttgcggtctatcgcaagcaatatcagcccttgctg
atcagccgcctgatcaccagccagctcgattgcgatcgcttggactatctgctgcgcgat
agctatttcacgggggcaagttacgggcgtctggatctcgatcgcattttgtcagcactg
cgcttcgactctgagagcggcgagttagctgtggcggagaagggattggcggcgatcgag
cactacttggtggtgcgatcgttcatgtatagccaggtctacaaccatcccaaaaacatt
gtggctggctggatgttagtgcgaatttttgagcgggcccgtcagctctggcaggaacaa
ccgcgatcgctgtttgtggatccgctgctccagccttggtttgagcaacccgtcacggat
ctgagcttggaggaatacctagcggtcgacgacattgtctgcctctaccatctgcagcgt
tggcaggacagtgctgatcccctcttggccgatctctgccgccgctaccgcgatcgcgat
ctgcttaaagccctcaatctccgtaacctccctgctgagcagcagcagaccttactagag
cacagtcaacaattgattcgtaaccaaggacaggatccgactggctataccggcctttgc
cagacccaaagtcgtggctacaccctctaccaaagtgggattcgcctcgccaccgatcaa
ggattattggaaattagtcagcgatcgcccctgattcgtgccctgttggagccacctagc
caagcttggttgatctatccgcgagtgatcgaacagcccctcaagcagcaatggcagctc
gtccgaggcagctaa

DBGET integrated database retrieval system