KEGG   Synechococcus elongatus PCC6301: syc1774_c
Entry
syc1774_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: TPR_1 TPR_2 TPR_11 TPR_8 TPR_16 TPR_12 TPR_9 TPR_17 TPR_14 TPR_7 TPR_19 TPR_10 TPR_4 TPR_6 NARP1 BTAD TPR_15 PPTA ANAPC3 Coatomer_E TPR_5 ChAPs MIT
Other DBs
NCBI-ProteinID: BAD79964
CyanoBase: syc1774_c
CYORF: syc1774_c
UniProt: A0A0H3K422
Position
complement(1921100..1922191)
AA seq 363 aa
MSIPNGGSHQSLEALLAAYDFRLRHEPRNCTLWNNRGILLERLNRWTEALASYNCALEIT
PQRQEALNNRAIVLEHLGRLPEAVESYEQALAIDRQQPEVWNNRGIVLRKLGRLEDAIAS
YQQAIALAAHYAQAWANCGFALWQQGRYREAVRHYEQSVAIDPDQSSAWRQLGQIYLSVD
QPDQALRCLDQAIALQPQQATAWTWRGHALYNLGQYAAALTSYENAELLGDRPLLLSIQR
GHTLAQLERYEEALASYAAILPQLTGEAAAEVAYYQGLVWAYLQDWTAALAAFDQAIAGN
PDLAEAWYNRAALHARLDQPVAAIADLQQAIALDPDTYRSLAAEDPDYQTLHAHPDWIQL
QRA
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgtctataccgaacggtggctcccatcaatcactagaggctctactcgcggcctacgat
ttccgtctgcgtcatgaaccgcgcaattgcactctctggaataatcgcggcattctcttg
gagcgcctcaaccgctggacagaagcactggctagctacaactgtgcgttagaaattaca
cctcagcgtcaggaagccctcaataatcgggcgatcgtcctagagcatttggggcggcta
ccggaagcagtcgagtcctacgaacaagccctcgccatcgatcgccagcaacccgaagtc
tggaacaaccgtggcattgtcctgcgtaagctgggccgactagaggatgcgatcgccagt
tatcagcaagcgatcgcccttgccgcccactatgcccaagcgtgggccaactgtggcttt
gctctgtggcaacaggggcgctaccgggaggcagtacgtcactacgaacagtctgtggcg
atcgaccctgatcagagcagtgcttggcggcagctagggcagatttacctgagtgtcgat
caacccgatcaggccttgcgctgtttggatcaagcgatcgccctccaaccgcagcaggcg
acggcttggacttggcgcggtcatgccctctacaacctcgggcagtatgcagctgcactg
acctcctacgaaaacgcagaacttctgggcgatcgccccctcctgctgtcaatccaacgg
ggtcatacgctggcgcagctcgaacgctacgaagaggcgctggccagctacgccgcaatt
ctgccgcaattaacaggcgaagctgccgcagaggtggcctactaccaaggactcgtttgg
gcttacctccaggactggaccgcagcattggctgcttttgatcaggcgatcgcaggcaat
ccagacttggccgaggcttggtacaatcgcgccgccctccacgcccgactcgatcaaccg
gtcgcagcgatcgcggatctccaacaggcgatcgcgctagatccagacacctatcgttct
ctagctgctgaggatccggattatcaaacgcttcacgcacatcctgactggatccaactc
caaagggcttag

DBGET integrated database retrieval system