KEGG   Synechococcus elongatus PCC6301: syc1775_d
Entry
syc1775_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: PsiE
Other DBs
NCBI-ProteinID: BAD79965
CyanoBase: syc1775_d
CYORF: syc1775_d
UniProt: A0A0H3K789
Position
1922259..1922732
AA seq 157 aa
MAPRYRRLARLGQLWSDSDSFLTLVSSLEKFIAKVLSLAMIVVIIVSTIDLGIFLVKNLF
VFDPFFLKSALFEVFGMFLSVLIALEILENITAYLRRNVIQVELVVATSLIAIARKLIIL
DVNKISTGELFGLGFAVLALAISYWIVRSAPARNSHH
NT seq 474 nt   +upstreamnt  +downstreamnt
atggcgccccgatatcgtcgccttgcgagactcggacaactctggagtgactcagacagt
tttctgacgctcgttagtagtctcgaaaagttcattgccaaggtattgtcgctggcaatg
attgttgtgatcattgtctcgacgattgacctcggtatcttcttggtcaaaaatttattt
gtctttgatcctttcttcctcaagtccgctctattcgaagtttttgggatgtttttgagt
gtcttaattgccctcgaaatcctcgagaatatcaccgcttatctccggcgcaatgtcatc
caagttgaactagttgttgcgacctctttgattgcgatcgctcgtaaattaatcattctc
gacgtcaacaaaatttctacgggcgaactttttggactcggctttgcagtgcttgctcta
gccattagctactggattgtgcgatcggcacccgctcgcaattctcatcactag

DBGET integrated database retrieval system