KEGG   Synechococcus elongatus PCC6301: syc1776_c
Entry
syc1776_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K09797  uncharacterized protein
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    syc1776_c
SSDB
Motif
Pfam: SIMPL MCR_alpha Foamy_virus_ENV
Other DBs
NCBI-ProteinID: BAD79966
CyanoBase: syc1776_c
CYORF: syc1776_c
UniProt: A0A0H3K4G1
Position
complement(1922766..1923518)
AA seq 250 aa
MTETRHWAERLLHPHHFVVGLTILTLGLAWTGNTVVSNLRRGSDRLTVTGASTQRVTSDR
VTWRITVNRQAATLAAAYEALQPDLDRTVRFLEANGVQATEIQRGVINSFPIYQTLPNGT
NTNEVAAYRASQVLTIESKEVVRIQGLSQEIGQLLTEGVNLEIAPPAYTFSKLPEYRVEL
LAQATEDARKRAAAIAQQGGSQLAAIASAETGVFQITAPNSTDVGDGGSYDTSTIEKDMT
AVISVSFRLN
NT seq 753 nt   +upstreamnt  +downstreamnt
atgaccgaaactcgccactgggccgagagattactgcatccgcatcattttgttgttggg
ctgacgattttaacgctgggcctcgcttggacgggcaacacggttgtcagcaacctgcgc
cgcggtagcgatcgcctcacggtgactggcgcgagtacgcagcgcgtcacgtctgatcgc
gtgacttggcgaattaccgtcaaccgacaagcggcgaccttggccgcagcctacgaagcc
ctccagcccgatctcgatcgcacagttcgctttttggaagccaatggcgttcaagccaca
gaaattcagcgcggtgtgatcaactccttcccgatttaccaaaccctgcccaacggcacc
aacaccaacgaagtggcagcctatcgggccagccaagtgctgaccattgagagcaaggaa
gtagtccgtattcaaggcttgtcacaggaaattgggcaactcttaaccgagggtgtcaat
ctcgaaattgccccaccggcctacaccttcagcaagctgccagagtaccgggttgaacta
cttgcgcaggcaacggaagatgcccgaaagcgggcagcagcgatcgctcaacaagggggg
agccagcttgctgcgatcgccagtgccgaaacgggggtctttcaaattacggccccaaat
tccaccgatgtaggggatggcggcagctacgacaccagcacgattgaaaaagacatgact
gcagtaatttcagttagcttccgcttgaattaa

DBGET integrated database retrieval system