KEGG   Synechococcus elongatus PCC6301: syc1784_c
Entry
syc1784_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K09932  uncharacterized protein
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    syc1784_c
SSDB
Other DBs
NCBI-ProteinID: BAD79974
CyanoBase: syc1784_c
CYORF: syc1784_c
UniProt: A0A0H3K3R8
Position
complement(1927653..1928279)
AA seq 208 aa
MNVNTARTSAVIVHPVPPAYADCYLVWQQSITTAAAQFDGYQGTDIYPPENDRDPNWIAV
LHFQTPADLQGWLDSPQRAEILAQLPPELAGYSKTVLPQGFAPWFSQLLHKPPSWKMALT
VLLALYPTVLLLNLLITPHLQGLGRAGAVLVGNAIGVALMQWGIMPRLTRLLKPWLSADS
DRRFSVLGGAAIVSILLLLAHLFQRWFF
NT seq 627 nt   +upstreamnt  +downstreamnt
atgaatgtgaataccgccagaacctccgctgtgatcgtccatcctgtgccgcctgcctat
gccgattgctatctggtgtggcaacagtcaatcactactgctgccgcccaatttgatggc
taccaaggcacggacatctatccgcccgagaacgatcgcgaccccaactggattgctgtt
cttcacttccagactccggcagatctccaaggctggctcgattcaccgcagcgggccgaa
atcttagcccagctcccaccagaactggctggctattccaagaccgtcttgcctcaaggc
tttgctccctggtttagccagcttctccataagcccccgagctggaagatggcactgacc
gtgttgctagcgctctatcccaccgtgctgctgctcaacttgctgatcacaccgcatctg
caagggctcggcagagctggggcagttttggtcggtaatgcgattggcgtcgcactcatg
cagtgggggattatgccgcggctgacacgactcctcaaaccctggttatccgccgacagc
gatcgccgcttctcagtcttgggtggggctgcgatcgttagcatcctgctgctgttggca
catctttttcagcgctggttcttttaa

DBGET integrated database retrieval system