KEGG   Synechococcus elongatus PCC6301: syc1789_dHelp
Entry
syc1789_d         CDS       T00163                                 

Gene name
groEL1
Definition
(GenBank) GroEL protein
  KO
K04077  chaperonin GroEL
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:syc00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    syc1789_d (groEL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:syc03019]
    syc1789_d (groEL1)
   03110 Chaperones and folding catalysts [BR:syc03110]
    syc1789_d (groEL1)
   03029 Mitochondrial biogenesis [BR:syc03029]
    syc1789_d (groEL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syc04147]
    syc1789_d (groEL1)
Messenger RNA biogenesis [BR:syc03019]
 Prokaryotic type
  Bacterial mRNA degradation factors
   Other RNA degradation factors
    Chaperones
     syc1789_d (groEL1)
Chaperones and folding catalysts [BR:syc03110]
 Heat shock proteins
  HSP60 / Chaperonin
   syc1789_d (groEL1)
Mitochondrial biogenesis [BR:syc03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    syc1789_d (groEL1)
Exosome [BR:syc04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   syc1789_d (groEL1)
  Exosomal proteins of other body fluids (saliva and urine)
   syc1789_d (groEL1)
  Exosomal proteins of breast cancer cells
   syc1789_d (groEL1)
  Exosomal proteins of colorectal cancer cells
   syc1789_d (groEL1)
  Exosomal proteins of bladder cancer cells
   syc1789_d (groEL1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cpn60_TCP1 GAF_2
Motif
Other DBs
NCBI-ProteinID: BAD79979
CyanoBase: syc1789_d
CYORF: syc1789_d
UniProt: P12834
Position
1933780..1935414
Genome map
AA seq 544 aa AA seqDB search
MAKRIIYNENARRALEKGIDILAEAVAVTLGPKGRNVVLEKKFGAPQIINDGVTIAKEIE
LEDHIENTGVALIRQAASKTNDAAGDGTTTATVLAHAVVKEGLRNVAAGANAILLKRGID
KATNFLVEQIKSHARPVEDSKSIAQVGAISAGNDFEVGQMIADAMDKVGKEGVISLEEGK
SMTTELEVTEGMRFDKGYISPYFATDTERMEAVFDEPFILITDKKIGLVQDLVPVLEQVA
RAGRPLVIIAEDIEKEALATLVVNRLRGVLNVAAVKAPGFGDRRKAMLEDIAVLTGGQLI
TEDAGLKLDTTKLDQLGKARRITITKDNTTIVAEGNEAAVKARVDQIRRQIEETESSYDK
EKLQERLAKLSGGVAVVKVGAATETEMKDRKLRLEDAINATKAAVEEGIVPGGGTTLAHL
APQLEEWATANLSGEELTGAQIVARALTAPLKRIAENAGLNGAVISERVKELPFDEGYDA
SNNQFVNMFTAGIVDPAKVTRSALQNAASIAAMVLTTECIVVDKPEPKEKAPAGAGGGMG
DFDY
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacggatcatttacaacgaaaacgcccgtcgcgcccttgaaaaaggcatcgac
attctggcggaagccgttgcagtcaccctcggccccaaaggtcgcaacgttgttcttgag
aaaaagttcggcgcaccgcaaatcatcaatgacggtgtgacgatcgccaaagaaatcgaa
ctggaagaccacatcgaaaacaccggtgtggcgctgattcgtcaagccgcttccaaaacc
aacgacgcagccggtgacggcaccaccaccgcaaccgtcttggcgcacgctgtggtcaaa
gaaggtctgcgtaacgtggctgctggcgctaacgccattttgctgaagcgcgggatcgac
aaagccaccaacttcttggttgagcaaatcaagtcccacgctcgtccggtcgaagactcc
aagtcgatcgcccaagtcggtgcaatctcggctggcaacgactttgaagtcggccaaatg
atcgccgatgctatggacaaagtcggcaaagaaggcgtcatctcgctggaagaaggcaaa
tcgatgaccaccgaactggaggtcaccgaagggatgcgtttcgacaagggctacatctcg
ccctactttgccaccgacaccgagcggatggaagccgtctttgacgagcccttcatcttg
atcaccgacaagaaaatcggtttggttcaagacttggtgcccgtgctggagcaagtggct
cgcgctggccgtccgctggtgatcatcgccgaggacatcgagaaagaagccctcgccacc
ttggtcgtcaaccgtctgcgtggcgtgctcaacgttgctgcagtcaaagcgcctggtttc
ggcgatcgccgcaaagccatgctggaagacattgctgtcctgactggtggtcaactgatc
actgaagacgcaggtctgaagctggataccaccaagcttgatcagctgggtaaagcccgc
cggatcacgatcaccaaagacaacaccacgatcgtggctgaaggcaacgaagcggctgtg
aaggcccgcgttgaccaaatccgtcgccaaatcgaagaaactgagtcgtcctacgacaaa
gagaagctgcaagagcgcttggctaagctctccggtggcgttgcagtcgtcaaagttggc
gcggcaaccgaaactgaaatgaaagaccgcaaactgcgtctggaagatgcgatcaacgcc
accaaagcggcggttgaagaaggcatcgtccctggtggcggcaccaccttggcgcacctc
gctcctcagctggaagagtgggcaaccgctaacctcagcggtgaagagctgaccggcgct
caaatcgtggctcgtgccttgacggctccgctgaagcggattgctgaaaacgctggcctc
aacggtgctgtgatctccgagcgcgtcaaagaactgcccttcgacgaaggctacgacgcc
tccaacaaccagttcgtgaatatgttcacggctggcatcgttgacccggccaaagtgact
cgtagtgccctgcaaaacgcagcttcgatcgcagccatggtgctgacgaccgagtgcatt
gtggtcgacaaaccggaaccgaaagaaaaagccccggctggtgctggcggcggcatgggc
gacttcgactactaa

DBGET integrated database retrieval system