KEGG   Synechococcus elongatus PCC6301: syc1790_cHelp
Entry
syc1790_c         CDS       T00163                                 

Gene name
murG
Definition
(GenBank) UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl -undecaprenol N-acetylglucosamine transferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00550  Peptidoglycan biosynthesis
syc01100  Metabolic pathways
syc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    syc1790_c (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    syc1790_c (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
    syc1790_c (murG)
Enzymes [BR:syc01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     syc1790_c (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:syc01011]
 Precursor biosynthesis
  Glycosyltransferase
   syc1790_c (murG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_trans_4_4 Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: BAD79980
CyanoBase: syc1790_c
CYORF: syc1790_c
UniProt: Q5N140
Position
complement(1935498..1936589)
Genome map
AA seq 363 aa AA seqDB search
MSSGPRVSVAQPRLLFAASGTGGHVFPALAVAEALPEAKIDWLGVPDRLETQLVGDRYPL
HTIRVGGFQGSWLLRPLTALRLIGAIFKVRRLLKRQQIEAVFTTGGYIAGPAIAAAWSLG
IPVVLHESNALPGKTTRLLSRFCRRVALGFAEAGEYLPGRPLQVVGTPLRSQFYQPSQHG
LPIPENVPVLLVMGGSQGAVAINRLVRAAAPAWLAAGLWIVHLTGQQDPDRGQLQHPQYI
ELSFVDNVAPLLNRADFSISRAGAGSLAELAAAGLPSLLIPYPFAAEDHQTFNARIFAKA
GAAILAPQSELTVEQLQQQILDLLRARLGAAIANPLPKMAAAAGKLHVADSAEQVANLLR
SLL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtcaggtccccgtgtgtctgttgctcaaccgcgcctcctctttgctgctagcggc
accggtggccatgtctttccggctctagcggttgctgaagcactgcctgaagcgaagatc
gattggctgggcgtgcccgatcgcctcgagacgcaattggtgggcgatcgctatccactc
catacaatccgcgtcggcggctttcagggatcttggcttctgcgaccgttgacagcgctg
cgcttgattggcgcaatttttaaggtgcgacgcctgttgaagcgacagcaaatcgaagca
gtcttcacgacgggcggctatattgcgggtcctgcgatcgcggccgcttggagtctggga
attcccgtcgttctgcatgaatcaaacgcactgccgggcaaaacaacacgcttacttagc
cggttttgtcgacgtgttgcccttggctttgccgaggctggcgagtatctaccgggtcgg
ccgctgcaagtagtcggcaccccgttgcgatcgcagttttatcagcccagccagcatggt
ctgccaattcctgagaatgtgccagtcttgctagtgatgggtggcagccaaggcgcagtc
gccatcaatcggttagtgcgagctgctgctcctgcttggttggcagcaggcctgtggatc
gtgcatctgaccggccagcaagatcccgatcgcggccagctccaacatccgcagtacatc
gagctgtcgtttgtcgacaacgttgcgccgcttttgaatcgagccgacttttcgatcagt
cgcgccggtgctggcagtttggcggaattggcagcggccggattgcctagcttgctgatt
ccctatccctttgccgcagaagatcaccagacctttaacgcccgcatttttgccaaggct
ggggccgcgatcctagccccgcaatcagaactgacggtagagcagcttcagcagcagatc
ttggatttgttacgggcgcgactgggcgctgcgatcgccaatcccttgccgaagatggcg
gctgccgcaggcaaactccacgtcgctgacagcgctgaacaggttgccaatctgctgcga
tcgcttctgtaa

DBGET integrated database retrieval system