KEGG   Synechococcus elongatus PCC6301: syc1792_dHelp
Entry
syc1792_d         CDS       T00163                                 

Definition
(GenBank) L-2-diaminobutyrate decarboxylase
Organism
syc  Synechococcus elongatus PCC6301
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: BAD79982
CyanoBase: syc1792_d
CYORF: syc1792_d
UniProt: A0A0H3K7A1
Position
1937970..1939250
Genome map
AA seq 426 aa AA seqDB search
MPLPDLLQQLEPLLAQAMNPANPGYLGHMDPVASTASVIGDAIAALLNNNLLSVEMSPSF
SRLETAVLRELAQRFGLGDEAGGLLLSGGSLANLQAIALARNWALQVQETGLAGLTQRPI
LFASEAAHTSIQKAAMLLGLGSQAVIPIATDRRGRMQVAALTEAIASARRQGQRPFCLVA
TAGTTVTGSIDPLPELSAIARTEGLWFHVDASYGGAVIFSPRYAHKLQGIEQANSVTFNP
QKWLCVAKTSASLLLRDWSLLTEHFRIAAPYMGEADDLINLGEVSVQGTRPADILKLWLT
LQHFGDRGCAALVEHGLRLCRCFVAELRQRPQIQVATPPDLNILCFRLASDRLTAELQQF
LLDRYFFLSLPRFRDRLWLKAVLVNPFTTPEHIRQLFGAIDAFCRDRQIQPDPQSQDNEI
TYSQSL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
gtgcccttgccggacctactgcagcaactggagccgctgctggcgcaagcgatgaatcca
gccaatccgggctatctcggccacatggatccggtggcgagcactgcgtcagtcattggt
gatgcgatcgcagcacttctcaacaacaatttgctcagcgtcgagatgtcgcccagcttc
tcgcgcttggaaacggctgtcctgcgagagttagcgcaacggtttgggctgggggacgag
gctggaggattgctgctgagcggcggcagtctcgccaatcttcaagcgatcgccctggca
cgcaattgggccttgcaggtacaggaaactggcctggccggactaactcagagaccaatt
ctgtttgcctctgaagctgcccatacttcgattcagaaagcggcgatgctgctggggcta
gggagccaagccgtgattccaatcgcaaccgatcgccgaggtcggatgcaagttgccgcc
ctcacagaagcgatcgcctcggcccgccgccaaggtcagcgtccattttgtttggtcgca
actgcaggcaccaccgtcactggcagcattgatccactcccagaactgagcgcgatcgcc
cgtactgaagggctgtggttccacgttgatgcctcctatggcggagctgtgatcttttcg
ccgcgctatgcccataagctccagggcattgagcaggctaattccgttaccttcaatccg
cagaagtggctctgtgttgctaaaacgagcgcttcgttactgctgcgcgactggtcgtta
ctgaccgagcacttccgcattgctgcgccctatatgggtgaagctgacgacctgatcaac
cttggtgaagtctctgtccaaggcactcgaccggcagacattctcaagctctggttgacg
ctccaacacttcggcgatcgcggttgtgctgcgctggtggaacatggcctacgactgtgc
cgctgctttgttgcagaattgcgccaacgcccccagattcaagtggcgaccccgcccgat
ttgaatatcctctgtttccgtttggcgagcgatcgcctgactgcggagctgcagcaattt
ctcctcgatcggtacttcttcttgtcactgccaagattccgcgatcgcctctggctgaag
gcggtgctggtcaacccgtttacgacgcccgaacacatccgccaactctttggagcgatc
gatgctttttgtcgcgatcgccagatccagccggatccccaaagtcaagacaacgagatc
acttactcacagtcgttatga

DBGET integrated database retrieval system