KEGG   Synechococcus elongatus PCC6301: syc1801_c
Entry
syc1801_c         CDS       T00163                                 

Gene name
rps15
Definition
(GenBank) 30S ribosomal protein S15
  KO
K02956  small subunit ribosomal protein S15
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:syc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    syc1801_c (rps15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:syc03011]
    syc1801_c (rps15)
Ribosome [BR:syc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    syc1801_c (rps15)
  Bacteria
    syc1801_c (rps15)
  Archaea
    syc1801_c (rps15)
SSDB
Motif
Pfam: Ribosomal_S15
Other DBs
NCBI-ProteinID: BAD79991
CyanoBase: syc1801_c
CYORF: syc1801_c
UniProt: Q5N129
Position
complement(1947124..1947432)
AA seq 102 aa
MLLSEFAEARLSSMSLTQARKQEIFEAYQIHPTDTGSADVQVAVLSERISRLSQHLQQNK
KDFASRTGLLRLIGQRKRLLAYILKQDRDRYKALIERLGIRG
NT seq 309 nt   +upstreamnt  +downstreamnt
atgctactatcagagtttgctgaagcgcgactgagttccatgtccctgacccaagcccgt
aagcaggaaatttttgaggcctaccagatccaccccaccgacactggctcggcggatgtg
caagtggccgtgttgagcgagcggattagccgcctgagccaacacctgcagcaaaacaaa
aaagactttgcctcccgcacaggtctgctgcggttgatcggtcagcggaaacgcctgctg
gcttacatcctcaagcaagaccgcgatcgctacaaagccctgatcgagcgcctcggtatc
cgcggctaa

DBGET integrated database retrieval system