KEGG   Synechococcus elongatus PCC6301: syc1803_d
Entry
syc1803_d         CDS       T00163                                 

Gene name
tal
Definition
(GenBank) transaldolase
  KO
K00616  transaldolase [EC:2.2.1.2]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00030  Pentose phosphate pathway
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01120  Microbial metabolism in diverse environments
syc01200  Carbon metabolism
syc01230  Biosynthesis of amino acids
Module
syc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
syc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    syc1803_d (tal)
Enzymes [BR:syc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.2  transaldolase
     syc1803_d (tal)
SSDB
Motif
Pfam: TAL_FSA EF-hand_5 EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8
Other DBs
NCBI-ProteinID: BAD79993
CyanoBase: syc1803_d
CYORF: syc1803_d
UniProt: Q5N127
Position
1948307..1949500
AA seq 397 aa
MAANLLEQLRGMTVVVADTGGIQSIATFTPRDATTNPSLITAAAQMPQYQSIIDDTLRQV
RTELGAEAPVEAIVAEAIDELFVAFGLRILEIVPGRVSTEVDARLSYDTEATIAKARKLI
GLYERAGIRRDRVLIKIASTWEGIRAAEVLEKEGIHCNLTLLFGFHQAVACAEAGVTLIS
PFVGRILDWYKKESGRDAFPGAEDPGVQSVTQIYNYYKKFGYATEVMGASFRNISEIIEL
AGCDLLTISPGLLEELRQTEALLERKLDPAIAESLELEQIHLDRDRFAELHQADRMANEK
LDEGIRGFCKAIDTLEGLLKQRLAVLEGKAVFHHAAHEVFSVCDLDGDGFITREEWLGSD
AVFDALDLNKDGKLNEEDLLAGLGATLQMAGRAVATV
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcgaatttactcgaacaactccgcggaatgacggtggttgtcgcagacaccggc
ggcattcagtcgatcgcgacgttcacccctcgcgatgccaccaccaacccttctctgatc
acagccgcggcgcaaatgccgcagtatcaaagcattattgatgacacgctccgccaagtt
cggactgagctaggcgcagaagcccctgtagaagcgatcgtggctgaagccatcgatgaa
ctgtttgtcgcttttggcttgcgcattctcgaaattgtgccagggcgcgtttccacagaa
gttgatgctcggctctcctacgacaccgaagccacgatcgctaaagcccgtaagctgatt
gggctgtacgagcgggcaggcatccgccgcgatcgcgtgctgattaaaattgcctcaact
tgggaaggcatccgggctgctgaagtcctggaaaaagaaggcattcattgcaacctgacc
ctgctgtttggcttccaccaagctgtggcctgcgctgaggccggcgtcaccctcatctcg
ccttttgttggtcgcatcctcgattggtacaagaaggaatccggacgcgacgctttccca
ggggcagaagatccgggcgtccagtccgtcacccagatttacaactactacaaaaaattc
ggctatgcgacggaagtgatgggcgctagcttccgtaacatcagcgagatcattgaactg
gcgggctgcgacctcctgacgatctcgccggggctactggaagagttacgccagaccgaa
gcgctactggagcgcaagctcgatcccgcgatcgctgaaagccttgagctggagcaaatt
cacctcgatcgcgatcgctttgctgaactccaccaagccgatcgcatggccaatgaaaag
ctagacgaaggcattcgtggtttttgcaaggcgatcgataccctcgaaggcttgcttaag
caacgactagccgtgctggaaggcaaagccgttttccaccacgctgcccacgaagttttc
agcgtctgcgaccttgatggcgatggctttatcacccgtgaggaatggctgggcagcgat
gctgtctttgatgcactcgacctgaacaaggacggcaagctcaacgaagaggacttgctc
gccggtctcggggctaccttgcaaatggcggggcgagcggttgcgaccgtctaa

DBGET integrated database retrieval system