KEGG   Synechococcus elongatus PCC6301: syc1804_d
Entry
syc1804_d         CDS       T00163                                 

Gene name
glnA
Definition
(GenBank) glutamate--ammonia ligase
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00220  Arginine biosynthesis
syc00250  Alanine, aspartate and glutamate metabolism
syc00630  Glyoxylate and dicarboxylate metabolism
syc00910  Nitrogen metabolism
syc01100  Metabolic pathways
syc01120  Microbial metabolism in diverse environments
syc01230  Biosynthesis of amino acids
syc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    syc1804_d (glnA)
  09102 Energy metabolism
   00910 Nitrogen metabolism
    syc1804_d (glnA)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    syc1804_d (glnA)
   00220 Arginine biosynthesis
    syc1804_d (glnA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    syc1804_d (glnA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:syc04147]
    syc1804_d (glnA)
Enzymes [BR:syc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     syc1804_d (glnA)
Exosome [BR:syc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   syc1804_d (glnA)
SSDB
Motif
Pfam: Gln-synt_C Gln-synt_N
Other DBs
NCBI-ProteinID: BAD79994
CyanoBase: syc1804_d
CYORF: syc1804_d
UniProt: A0A0H3KAV7
Position
1949634..1950956
AA seq 440 aa
MGVERDMDSLAALARDRGIRYFLIAFTDLFGVQRAKLVPASSIDLMATSGAGFAGFAAWL
DLSPADADVLAIPDRDSLFQLPWQPEVAWMPADLYLNDQPLEQAPRWVLKRVLSVAESLG
YRPKTGVECEFFLLDETGDAIADPRDRQAKPCYDQQSLMRRYDLITQISEAMEELGWGPY
QSDHEDADGQFEMNWTYADALVTADRQAFFKYMVKTLAERQGLRATFMPKPFADLTGNGC
HMHLSLWNREGTTNTFVDPVATAPLSTLGYQFIGGLLHSAASLCALTNPTINSYKRINAP
ATTSGATWSPNGISYSGNNRTHLIRIPDAGRFELRLADGAANPYLLPAAAIAAGLDGIQN
KRDPGPRYDNDNYAQPLPPGTVPTLPEHLLDALRSLQESTVLTEGLGAAFTSAYLKLKHQ
EWRSFCAEITPWERATTLDC
NT seq 1323 nt   +upstreamnt  +downstreamnt
gtgggtgtggaacgagacatggattctttggcagccttggcgcgcgatcggggcattcgt
tactttctgattgccttcaccgatctatttggcgtacagcgagccaagctggtgccagcc
agcagcatcgacctcatggccactagtggtgcgggctttgccggttttgcagcttggctt
gatctcagcccagcggatgcggacgttttagccattcccgatcgcgacagtctgttccaa
ctgccttggcaaccggaagtcgcttggatgccagcagatctctacctcaacgatcaaccg
ctggagcaagcgccgcgctgggtactaaagcgggttctctcggtggctgagtccctcggc
tatcgccccaaaacaggggtggagtgtgagttcttccttctggatgaaaccggagatgcg
atcgctgatccgcgcgatcgccaggcgaaaccttgctacgaccagcagtccctgatgcgg
cgctacgacctgattacccagatcagtgaagcgatggaggaactgggctgggggccgtat
caaagtgatcatgaagatgccgacggtcagtttgaaatgaactggacctatgcggatgcg
ctagtcactgccgatcgccaggctttcttcaagtacatggtcaaaactctcgcggaacgg
caaggattaagggctacctttatgcccaagcccttcgcggatttgaccggcaatggttgc
cacatgcacctttcactctggaatcgggagggcacaaccaatacttttgtcgatccggtt
gcgactgctcccctctcgaccctgggctatcagtttattggtggattgctgcattcggcg
gcatccctctgcgccctcaccaacccaaccatcaactcctataagcggattaatgcaccg
gcgacgacctcgggtgcgacttggtctccgaacggtattagctacagtggcaacaaccgc
acccacctgatccgtattcccgatgccggtcgctttgagttgcgactcgccgatggggct
gctaacccttacctgttgcctgctgccgcgatcgctgccggcttagatggtattcagaac
aaacgcgatccaggcccccgctacgacaatgacaactatgctcagcccttaccacccggc
acagttccgaccttgcccgagcatttgctggatgccctgcgatcgctacaagaaagcact
gttctcaccgaaggtttgggagctgcgttcacaagtgcatacctcaagcttaagcatcag
gaatggcgcagtttttgtgctgaaattaccccttgggagcgcgctacaaccttggattgc
tag

DBGET integrated database retrieval system