KEGG   Synechococcus elongatus PCC6301: syc1806_c
Entry
syc1806_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Glyco_transf_8 Glyco_transf_24
Other DBs
NCBI-ProteinID: BAD79996
CyanoBase: syc1806_c
CYORF: syc1806_c
UniProt: A0A0H3K438
Position
complement(1952040..1952876)
AA seq 278 aa
MADPIRIFIGSGEASRIERQVAIDSLQRMTDRPLAITAFNGTHNALEVLGEPPRPAPMSL
RVKYWNATEFSLYRFLIPELCGYQGRAIYIDSDVVCLHDIGELFDTDLEGADFLAKAEAY
PDRAGALWGLSVVLFDCDRCRFPLEQFIDELEAGVYDYRDLPCMGPRFLNKRPYQIGALD
PRWNSFDFADRETRLIHYTDLKRQPWKRPGHPYGDLWFKAMQQALDSGILTDTEISQAIK
RFNVRDDIREGNRPRWLTRQRLRSWLRQVKQQLRPVKV
NT seq 837 nt   +upstreamnt  +downstreamnt
atggccgatcccattcgcatcttcattggttccggagaagccagccgcattgagcggcaa
gtggcgatcgattcgctacaacggatgaccgatcgcccgttggcaattacggcgtttaac
ggcacccacaacgccctagaggttttaggagagccaccccgtcccgcccccatgtcactg
cgggtcaagtactggaatgcgacggagtttagcctctaccgttttttgattccagaactc
tgcggctaccaaggccgcgccatctacatcgactccgatgtggtttgcctacacgatatt
ggcgaactgtttgacactgatctggaaggggcagacttcctcgccaaagccgaagcctat
cccgatcgcgctggtgctctctggggtttgagtgtcgtcctgtttgattgcgatcgctgc
cgatttcccctcgaacagttcattgatgaactggaagccggtgtttacgactatcgcgat
ctgccctgcatgggaccgcgctttttgaacaaacgcccctatcagatcggggcactggat
ccacgctggaatagctttgactttgccgatcgcgaaactcgactgatccattacaccgac
ctcaagcgtcagccttggaaacgacccggtcatccctacggcgacctctggttcaaggcc
atgcagcaggcactcgactccggcatcctcacagacacagaaattagccaagcgattaag
cgcttcaacgtccgcgacgatatccgagaaggcaaccgaccgcgctggctgactcggcag
cgtttgcggtcctggctgcgccaagttaagcagcaactgcgtccggtcaaggtctga

DBGET integrated database retrieval system