KEGG   Synechococcus elongatus PCC6301: syc1807_c
Entry
syc1807_c         CDS       T00163                                 

Definition
(GenBank) unknown protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: PK_C
Other DBs
NCBI-ProteinID: BAD79997
CyanoBase: syc1807_c
CYORF: syc1807_c
UniProt: A0A0H3K7B4
Position
complement(1952909..1953358)
AA seq 149 aa
MTVRSRFLQKTWQRYREPIVMITIALGFLGCMGLRIQWDFAEHQARLQALQAQGALPLAT
PDSQTTPNRTVEAAIRYAIDQNLIPNGDNDCLTGEYRYQLARYGLRVDCRGESEPEWQGY
GIIPPPPEAAMRQPLPAAQSGLLSAPAAQ
NT seq 450 nt   +upstreamnt  +downstreamnt
atgactgtgcgatcgcgctttctgcagaaaacttggcaacgctaccgagaaccgatcgtg
atgatcacaatcgccctaggttttctcggttgtatggggcttcggattcaatgggacttt
gctgaacatcaggcccgtctacaagctctgcaggcccagggggcactgccactcgcgacc
cctgactctcagaccacgccgaatcggacggttgaggccgctatccgctatgcgatcgac
caaaacttgattcccaatggtgataacgactgcctgaccggagagtatcgctatcaattg
gcacgctatggccttcgcgttgattgtcgcggggagtctgagcccgagtggcagggctac
ggcattattccacccccacctgaggctgcgatgcggcaacctctgccagcggcacaatcg
ggcttgctgtcagctccagcagcacagtag

DBGET integrated database retrieval system