KEGG   Synechococcus elongatus PCC6301: syc1808_c
Entry
syc1808_c         CDS       T00163                                 

Definition
(GenBank) unknown protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Other DBs
NCBI-ProteinID: BAD79998
CyanoBase: syc1808_c
CYORF: syc1808_c
UniProt: A0A0H3K4H6
Position
complement(1953363..1955627)
AA seq 754 aa
MMPSPAGSFRVSVIPLWLASTLLPLWPEASLASLGLWLIWQTLSNRDRRFPWQPVAIATL
LCSPAIVRALTRDWSVGQSEMLWLTGVIVSGWLSLSDQQRSQVTLSLGLAPLLSLPTLIW
SDSLNPMMLTVTWAATGLWAIAILFNFTDQPQRLSPAWRWPLGIAAAIGLGGSWWLGSFT
LRLGWGVGLLIVVLLQRWGITLWRTWTRSPLGRLGVISTGIGLGLLWPFPTAVLAPDPAG
LLWRCAQDQIQHNLLRWLVGRGVQSVTTTCSTLTGETADNMSGLLQLWAELGLLGLAAVL
TLGFVAGDRYRQLLASSDLPRSQLGGGAALLGFWVVMLLFQTDWLNSGLTPLLLGLSLAI
PWTRSLPLRLPTTVDWLLLVALALQVNSAFWAVPLAGSWLVICVIEQLQQRDWRGLGCWA
TIALIFLPPAFWAKPTLDPSVTWSAYVLLGFGLIGSTGLGHDRSLRLLRWIGLLPLIWLL
LNLQAINWTIRISMGDLYINQVGILTVIATVPALLLTWRDRTWRGLYLLSSLAGGVIILG
TASRICLGAFVLAIGMTGVLNWQGRSRRSLIWLLPGFGLLLLGVIALRPDLVGRYLEFYD
PARIAIARCYVSQAWMNGPVSFWVGQGYGQAAAICQPPLTLNRVSHAHNFVLQLLADNGI
LVLAIVLVGLTATVIRLWQQIQQSADADQQLLRQWLLVSLVTGLVLHLFEGSFFKLPLLQ
LLIGLLLGLPWLGHLMPSRSPQTKGLPTSSSPLA
NT seq 2265 nt   +upstreamnt  +downstreamnt
atgatgccatctccagccggctcgttcagggtctctgtcattcccctctggcttgccagt
actctgctgccactctggcccgaagccagtctcgccagtctggggctgtggctgatctgg
cagacgttgagcaaccgcgatcgccgctttccgtggcaacccgtcgcgatcgccactctg
ctctgcagccccgccatcgtccgggctttaactcgggactggtcagtcggtcaaagtgag
atgctctggctgacgggggtgatcgttagtggttggctcagcctttccgatcaacagcga
tcgcaagtgacgctgagcttgggtctagccccgctgctcagcctgccgactctgatctgg
tcggactcactgaatcccatgatgctgaccgtgacttgggcggcgactgggctgtgggcg
atcgcaattctcttcaacttcaccgatcaaccccagagactctctccggcttggcgctgg
cccctcggtatcgcagccgcgatcggtctgggcggaagttggtggctgggttcttttacc
ctgcgtctcggctggggggtagggctactgattgtggtgctgctgcagcgctggggaata
actctctggcgaacctggacgcgatcgcccctaggacgtttgggggtgattagcactggc
attggtctcggactactctggccgtttccgacagctgttttggcaccggatcctgctggg
ttactctggcgctgcgcccaggaccaaattcaacacaacctgctgcgttggctggtaggg
cggggtgtgcaatctgtcaccaccacttgcagcaccttgacgggcgagacagctgacaac
atgagcggcctgttacaactctgggcagagttggggctactcggcctagcggcagtcctc
accctgggatttgtggcaggcgatcgctatcgccaattgctcgccagtagtgatttaccg
cgatcgcagctcgggggcggtgctgcactccttggcttctgggtcgtgatgctgctattt
cagaccgactggctcaacagcgggttaacacctctactgctgggtctaagcttggccatt
ccctggacgcgatcgctaccacttcgcctccctacaacggtcgattggctcttgctagtt
gcacttgcactccaagtcaatagtgcattttgggccgttcctttagcaggtagctggctg
gtgatttgcgtgattgagcagcttcagcagcgagattggcgcggtttgggttgttgggcg
acgatcgccttgatcttcttgccgccggctttctgggctaagccgactctcgatccctca
gtaacctggtcagcctacgtcctactgggctttggtttaattggttccacgggtctcggg
cacgatcgcagcctacggcttctgcgctggatcggtcttctccccttgatctggctactg
ctgaatttgcaggcgatcaactggacgattcgcatcagcatgggcgatctctacatcaac
caagtcggcattttgactgtgatcgctaccgtgccagcgttgctgctaacttggcgagat
cgcacttggcgaggtctttacctactctctagcttggccggtggcgtcattatcctcgga
accgcctcgcgcatttgcttgggagcgttcgttctggcgattggtatgacaggcgtcctc
aactggcaaggccgatcgcggcgatcgttgatttggctgctgccgggctttggcctccta
ttgctaggtgtcatcgcacttcgacctgacctcgtcggccgttacctcgagttctatgac
cccgctcggatcgcgattgctcgctgctatgtcagtcaagcttggatgaacggacccgtc
agtttctgggtgggccaaggctatggtcaagctgccgccatttgtcagccgccgctcacc
ctcaatcgggtctcacacgctcataactttgtgctgcagctcctagctgataacggcatc
ctagttctggcgatcgtgttggtcgggctgacagccactgtgatccgactctggcaacag
atccaacaatcagccgatgccgaccagcaattactgaggcaatggctcttagttagcctc
gtgaccggcctcgtactccacctgtttgagggcagtttcttcaagctccccctcctccag
ctgttaattggcctcctgctgggcttaccgtggctggggcacttgatgcccagccgatct
ccccaaaccaaggggctacccacctctagttctccgctcgcctga

DBGET integrated database retrieval system