KEGG   Synechococcus elongatus PCC6301: syc1810_d
Entry
syc1810_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K00979  3-deoxy-manno-octulosonate cytidylyltransferase (CMP-KDO synthetase) [EC:2.7.7.38]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00540  Lipopolysaccharide biosynthesis
syc01100  Metabolic pathways
Module
syc_M00063  CMP-KDO biosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    syc1810_d
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:syc01005]
    syc1810_d
Enzymes [BR:syc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.38  3-deoxy-manno-octulosonate cytidylyltransferase
     syc1810_d
Lipopolysaccharide biosynthesis proteins [BR:syc01005]
 Unusual sugar
  syc1810_d
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3 IspD
Other DBs
NCBI-ProteinID: BAD80000
CyanoBase: syc1810_d
CYORF: syc1810_d
UniProt: Q5N120
Position
1956763..1957497
AA seq 244 aa
MVRILAVIPARYASERLPGKVLLPIAGRPMLQWVYEATIASNVFDQVAIATEDPRVVEAA
AAFGAEAILTSADLASGTDRVAEASLHFPDCKVIANVQGDQPFVTPGLLQALVSPYRAGE
LPEMTTVGGPYDPAQDADDPNTVKVVCDQRGNALYFSRSAIPYPRTVVHDLPVYHHFGLY
AFRRDFLAQYRQLPPTPLERCESLEQLRVLEQGYRIRVVPCADKVIEVNTADDLERANAW
ASQR
NT seq 735 nt   +upstreamnt  +downstreamnt
atggttcgaattctggcagtgattcccgctcgctacgcctcagagcggctacccggcaag
gtactgctgccgatcgccggtcgaccgatgctgcagtgggtctacgaagccacgatcgcc
agcaatgtctttgatcaggtggcgatcgccacggaagatcctcgagttgtagaagcagca
gcggcttttggtgctgaagcgattctgaccagtgcggatctggcttcaggcaccgatcgc
gttgcggaagccagcttgcacttccctgactgcaaagtgatcgccaacgtccaaggcgat
cagccgtttgtgacgccgggattgctgcaagccctcgtttcgccctaccgggcgggggaa
ctgccggagatgacgacggtgggcggcccctacgatccagcgcaggatgctgatgatccc
aacacagtcaaagtggtctgcgatcaacgcggcaatgccctttatttctcgcgatcggcg
attccctatcctcgaaccgtggtgcatgacctgccggtctatcatcactttggcctctac
gctttccggcgcgattttctggcgcaatatcgtcaactcccgccgaccccactggaacgc
tgcgaaagtttggagcagttgcgggtgctagaacagggctatcggatccgggtggtgccc
tgtgccgataaggtcattgaagtcaacacagcagacgatctggagagggcaaacgcatgg
gccagtcaacgctaa

DBGET integrated database retrieval system