KEGG   Synechococcus elongatus PCC6301: syc1815_d
Entry
syc1815_d         CDS       T00163                                 

Gene name
gldA
Definition
(GenBank) glycerol dehydrogenase
  KO
K00005  glycerol dehydrogenase [EC:1.1.1.6]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00561  Glycerolipid metabolism
syc00640  Propanoate metabolism
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    syc1815_d (gldA)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    syc1815_d (gldA)
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.6  glycerol dehydrogenase
     syc1815_d (gldA)
SSDB
Motif
Pfam: Fe-ADH Fe-ADH_2 DHQ_synthase AIRC PFK NAD_kinase
Other DBs
NCBI-ProteinID: BAD80005
CyanoBase: syc1815_d
CYORF: syc1815_d
UniProt: A0A0H3K4I0
Position
1961180..1962259
AA seq 359 aa
MLRGWGALSEAGSAIARVGQRPLVVGGDRARALVQDSLTAIASEQSLTLGWGSSLPDCSE
AVLARLQQAATEHQADCILGVGGGKALDTAKLLGHQLSLPVITVPTSAATCAAWTALANV
YTDAGAWLYDVGLDRCPELLILDFELIAQAPPRTLAAGIGDAIAKWYEASVSSGHRQETL
VVAAVQQARVLRDLLFQKSAAAIAEPGGEQWYEVVEATVLLAGVIGGLGGAQCRTVAAHA
VHNGLTHLPACHDWLHGEKVAFGILVQLRLEELQGTNPLAATARQQLLSFYADLGLPRQW
SDMGLASVSLADLQQAAILACAPESDIHHLPFAVDPDQLLAAMVSTTTPIARSNSVVAE
NT seq 1080 nt   +upstreamnt  +downstreamnt
gtgttacgaggctggggcgcactctcagaggcaggatctgcgatcgcccgcgttggtcag
cgtccccttgtggtgggtggcgatcgcgccagagcactcgtccaagacagtttgacggcg
atcgcttcagaacaatccctgaccctaggttggggcagcagcttgccggactgtagtgaa
gcggttttggcacggctccagcaagcagcaaccgagcatcaagctgattgcattctaggt
gtgggcggcggtaaggcgctcgatacggccaaactgctggggcatcaactgtcgctgccg
gtgatcaccgtgccgacgagtgcggcgacctgtgcggcttggacagcattggcgaatgtc
tataccgatgccggggcttggctctacgatgtcggtctcgatcgctgtcctgagttgctg
attctcgactttgaactgattgcccaagcgcccccccgcaccctagcggcgggaattggg
gatgcgatcgccaagtggtacgaagcttccgtcagcagtggtcatcgccaagaaactttg
gtcgttgcggcggttcagcaagctcgtgtcctgcgtgatctgctcttccagaaatcggct
gccgcgatcgcggaacctggcggtgagcaatggtacgaagtggtggaagccaccgtttta
cttgcaggcgtgattggggggttaggtggggcgcaatgccgcacggtggctgcccatgct
gtccacaatggcttgacccatctgcccgcttgtcatgattggctgcacggcgagaaggtt
gccttcggtattttggtgcagttgcgtttagaagaactgcaaggcaccaacccgctggca
gcaaccgcacggcaacaactgctgagcttctatgccgatctggggctgccgcgccaatgg
tctgacatgggcttagcgtccgtcagcttagcggatttgcagcaagcggcaattctggcc
tgtgcgcccgagtcggacattcaccacctgccttttgcggtggatcctgatcagcttttg
gcggcgatggtttccacgactaccccgatcgcccgcagcaacagtgtggtggctgaatga

DBGET integrated database retrieval system