KEGG   Synechococcus elongatus PCC6301: syc1816_d
Entry
syc1816_d         CDS       T00163                                 

Gene name
todF
Definition
(GenBank) 2-hydroxy-6-oxohepta-24-dienoate hydrolase
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Ndr Thioesterase Esterase tRNA_NucTran2_2 Abhydrolase_2
Other DBs
NCBI-ProteinID: BAD80006
CyanoBase: syc1816_d
CYORF: syc1816_d
UniProt: A0A0H3KAX2
Position
1962256..1963167
AA seq 303 aa
MTAIAPETRLGSTVANLTEDTSKNLAAAIQWQAVATDLREAPIETSFVQLGQGDRPLLCL
HGFDSSVFEFRRLLPQLAEQHSVRALDCLGFGFTERPEGIEISPDTIRQHLWGCWQAWYQ
KPIVLVGASMGGAIAIDFALNYPEAVAGLILIDSAGIAPGPWIGRFLPSPLDGWAVDFLG
RPDVRRRISERAYHDPQRWVTPDAETCAALHLQQPGWREGLRRFTRSGGYGSMRSRLPEL
RQPTQLVWGRQDQILGTKDAAVFQRLLPQSELVWIDDCGHVPHKEQPRATAEAIATFVAT
LPT
NT seq 912 nt   +upstreamnt  +downstreamnt
atgactgcgatcgcgcctgaaacccgcctcggttcaaccgttgccaacctaacggaagac
acctccaagaacctagctgccgcaattcagtggcaagcggtcgctacagatttgcgcgaa
gccccgatcgaaactagctttgtgcagttgggacagggcgatcgcccgctgctctgtctg
catggcttcgacagctccgtgtttgaattccgccgcctcttgccgcagctcgcagaacag
cattcagtccgagcgctggactgtctgggttttggattcacggaacggcctgaagggata
gaaattagtccagataccattcggcagcatctctggggctgctggcaggcttggtatcag
aaaccaatcgtgctggttggggcttcgatgggtggggcgatcgcgatcgatttcgccctg
aactatcccgaggcggtggccggtttgatcttgatcgatagcgccggtattgcaccgggg
ccgtggattggtcgctttttgccatcgcccttagatggctgggcggtggactttctggga
cgaccggatgtgcgtcgtcgcatcagtgaacgggcctatcacgatccgcagcgttgggtg
acgccggatgctgaaacctgtgcggcgctccatctccagcaaccgggctggcgcgagggg
ctacgacgttttactcgcagtggcggctatggctcgatgcgatcgcgcctccctgaactt
cggcaacccacgcaactggtctggggtcgccaagatcagatcctcggcaccaaagatgct
gctgtttttcagcgcctgttaccgcagagtgagctggtctggattgatgactgcggccac
gttccgcataaagaacaacccagagcgacggctgaagcaatcgcgacttttgtggcgact
ttaccgacttga

DBGET integrated database retrieval system