KEGG   Synechococcus elongatus PCC6301: syc1818_d
Entry
syc1818_d         CDS       T00163                                 

Definition
(GenBank) two-component sensor histidine kinase
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DICT HATPase_c CHASE6_C GAF HisKA GAF_2 GAF_3 HATPase_c_3 HATPase_c_2
Other DBs
NCBI-ProteinID: BAD80008
CyanoBase: syc1818_d
CYORF: syc1818_d
UniProt: A0A0H3K448
Position
1964013..1965926
AA seq 637 aa
MADSTLAQLLEILRQQSFVDLPRPQIYFKASLTALSHALEDLVFATDEKPLLIASFQRER
FYRQEAHRYERLAHVTSAQFVLAAAESRFADADTYPAVAFPPSDPLALEWNLVVIGPRTT
GCLICMEKLDRQGPLEPAMDTARPFEGIWTTDRRVVTVAAELLLDRIAEFRPDLQAKTES
AIAALPPAEASAPSVETPFAERLLNYLQAGQYKLLKAYRAQARQTRKEQLINTISSAVRQ
SLNPEAVLEIAARELGLSLAANRCLIYACTPETEQILVEHEYRQTETASLGDRLWPLQEN
PLFQQVATDRKAIRLTVDDPEATLPYIQAMRQQWDIAHWLLIPVQYRQELIGMIELHREA
TAEPWDLADQELAEAIATQIGVALIQAQTFRQLENLERTRSNLTAIIGHELRTPLSTVQV
CLESLATEPDMSADLRQVMLQTALDDAERLRLLVQDFLTLSRLESGRIDWHPESLALDEC
VAMAMSGLRSRHQRDSLPSIEQKLPASLPLVRVDGDWLVEVLIKLLDNACKFTSAQGHVS
ITAVVEGDRALRVAITDDGRGIEPDRLEAVFDRFYQEDGALRRSQGGSGLGLAICRQIVE
RLGGHIWAESEGRDRGSCFQFTLPLATRHPQTANALT
NT seq 1914 nt   +upstreamnt  +downstreamnt
atggctgattccactcttgctcagttgctcgaaattttgcggcagcaatcttttgtggat
ttgccgcgtccgcaaatctacttcaaggcttcgctgacagccctgtcgcatgccctggag
gatttggtctttgccacggatgagaagccattattaatcgccagtttccagcgcgagcgc
ttctatcgccaagaagcccatcgctacgagcggctggcccacgtgaccagtgctcagttt
gtgctggccgccgcagaatcccgctttgccgatgcggatacctatcccgccgtggcgttt
ccaccctccgatccgctggccttggaatggaatctggtggtgattggccctcgcaccacc
ggctgcctgatctgcatggaaaaactcgatcgccaaggtcccttagagccggccatggat
acggcacgcccctttgagggcatttggaccaccgatcgccgcgtcgtcacggttgcagcc
gagcttctgctcgatcgcattgctgaatttcgacccgatttacaagccaagacagagtcg
gcgatcgcggcgcttcctcctgccgaagccagtgctcccagcgtcgaaacgccttttgct
gagcgcctgctcaactatctacaagccggacaatacaaactcctcaaggcctatcgcgcc
caggcccgacaaactcgcaaagaacaactgatcaacacgatcagtagtgcggtgcgccaa
tcgctcaatcctgaagcggttctcgaaattgccgcacgagaacttgggctgtcgctggct
gccaatcgctgtctgatctatgcctgcacgccggaaacggaacagattctggtggagcat
gagtatcgccaaaccgagaccgcttccctaggcgatcgcctctggcccctgcaagagaat
ccactcttccagcaagtcgccactgatcgcaaagcgattcgtctgaccgtcgatgatcct
gaagcgaccctgccttacatccaagcgatgcgacagcagtgggacatcgcccactggctg
ctaattccggtgcagtatcgccaagaactgatcgggatgattgaactccatcgcgaagcg
actgccgagccttgggatctcgcggatcaagaactggcagaagcgatcgcgactcagatt
ggggtggcactgattcaagcccagaccttccggcagctggaaaatctggaacgcacccgc
agcaatctgacggcgattattggtcacgagctgcgaacccccctctcgactgtgcaagtc
tgcctcgaaagtttggccactgagccggatatgagtgcggatctgcgccaagtgatgttg
cagacggctttggatgatgcggagcggctgcgcttgttggtgcaagattttctgaccctc
tcgcgtttggaaagtggccggattgactggcatccagaatcgctggcgctggatgaatgc
gtcgccatggcgatgagtggactgcgatcgcggcatcagcgcgactcactgcccagcatc
gaacaaaagctgcccgccagcttgccgctggtgcgggtggatggcgactggctggtggaa
gtgctgattaagctgctggacaacgcctgtaagttcaccagcgcccaaggccacgtttcg
attacggcggtcgtagaaggcgatcgtgccttgcgtgtggcgattaccgacgatggccga
ggaatcgaacccgatcgcctcgaagcagttttcgatcgcttctaccaagaagatggcgcg
ctacggcgcagccagggcggcagtggcctggggctcgcgatttgtcgccagattgtcgag
cgactgggtgggcatatctgggctgagtcagaagggcgcgatcgcgggagttgttttcag
ttcacgcttcctctggcgacccggcatccgcagacggcaaacgcactgacttaa

DBGET integrated database retrieval system