KEGG   Synechococcus elongatus PCC6301: syc1819_c
Entry
syc1819_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Other DBs
NCBI-ProteinID: BAD80009
CyanoBase: syc1819_c
CYORF: syc1819_c
UniProt: A0A0H3K7C6
Position
complement(1965874..1966830)
AA seq 318 aa
MAQTTSTAVFWGVICCFLPSSRECQPQALSLVPVPILAIAPPPPSPMRPAPIPPASEPLQ
YRAIGLVRGRYQPDPEVFTKGTLIANDGVSLDAVLLGRVLSLVKKHIDLSQEHLWVVYPR
TRDREGGLHMQIVGLWEPEMLTKRSQLTPGIRPPSPPKLQVSENFFSIRGEVVFTRPDLQ
RIVVRISQQAKTEPGERPAGFKLVLKGNLDLRALHHFWDFQVERQGEVLVVRQAEAVAAL
PGRRPKPKPQLRGQGQSSEHRSASYAAQAGEVRPQRSPLPRRVDQRDRPRPQPSGQKAPR
PIKSVRLPSADAGSPEEA
NT seq 957 nt   +upstreamnt  +downstreamnt
atggctcaaacaacctcaacagcagttttttggggggtcatttgctgtttcctgccgagc
agccgggaatgccagccccaagcgctatccttagtgccagtgccaatcttggccattgct
cctcctccgccgtcacccatgcgccccgctccgattcccccggctagtgaaccgctccaa
taccgagctattggcttggtacgcggacgatatcagcccgatcctgaggtattcacgaaa
gggaccctgattgccaatgatggggtcagccttgatgctgtgctcttgggacgagtgctg
agcttggtcaaaaagcacatcgatctcagtcaagagcacctctgggtggtctacccccgt
acccgcgatcgcgaaggggggctgcacatgcagatcgtcggtctctgggagccagagatg
ctgaccaagcgatcgcaactgaccccgggcattcggccacccagcccgcccaagctccaa
gtctcggagaactttttctcgattcggggtgaagttgtctttacgcggcccgacttgcag
cggattgtcgtccgcattagccagcaggctaaaactgaaccgggtgagcgacccgccgga
ttcaagctcgtgcttaaaggcaacctcgacctgcgagcgctccatcacttctgggacttt
caagtcgaacggcagggtgaagtcttggtggttcgccaagcagaagcagtggcggcgttg
ccgggccgtcgccccaaaccgaagccccaactacgaggtcagggtcaaagcagcgaacac
cgttccgcaagttatgcggcgcaagccggtgaagttcgcccccaacgcagtccactgccg
cgccgggtcgatcaacgcgatcgcccacggccccagccctcagggcaaaaagcccctcgt
ccgattaagtcagtgcgtttgccgtctgcggatgccgggtcgccagaggaagcgtga

DBGET integrated database retrieval system