KEGG   Synechococcus elongatus PCC6301: syc1821_c
Entry
syc1821_c         CDS       T00163                                 

Gene name
amt1
Definition
(GenBank) ammonium/methylammonium permease
  KO
K03320  ammonium transporter, Amt family
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syc02000]
    syc1821_c (amt1)
Transporters [BR:syc02000]
 Other transporters
  Pores ion channels [TC:1]
   syc1821_c (amt1)
SSDB
Motif
Pfam: Ammonium_transp Fijivirus_P9-2
Other DBs
NCBI-ProteinID: BAD80011
CyanoBase: syc1821_c
CYORF: syc1821_c
UniProt: A0A0H3KAX9
Position
complement(1968002..1969414)
AA seq 470 aa
MFDKRWRTLGLTAALAGISAFLLAHPTLAATAPQLTLEQLNSNVTAAKTGTDTLLLLIGS
ALVLLMTPGLAFFYGGFGRAQNVLNIMMMSFLMMGLVGMTWVIYGYSLAFDTSLGSPFIG
GFSNLFFNGVGGKFGIDPVWAGDELMISGMSASSFALFQGMFAIITPALISGALVERVNF
KAWFWFGLLWSTLVYIPMAHMVWGSNGFIYGQIGALDFAGSTVVHIASGVGALVSVAMIG
PRRVFPNRLSPPHNVPFILLGAGLLWFGWFGFNGASYFAAQGAGFAFLTTNTAAATAMLT
WLLLEQIDLGKPTAVGAATGAVAGLVGITPSAGFIPVWAALPIGALTALVCFLFVAKVKS
RIRLDDSLDAFGVHGVGGTVGAILTGIFAQKDFLVEKAFPTQFKVISQGPLAMTWAQIQA
VLITYLFVGIATFVIWTILKSVMRVRATEEQELEGLDFALHGEDAYSKER
NT seq 1413 nt   +upstreamnt  +downstreamnt
atgttcgacaaacgatggcgaactctgggtttgactgcagcactggctggcatttctgca
tttctgctggcccatccaactctggcagcaactgcacctcagctaacgctggagcagctc
aatagcaacgtcactgccgccaagactggaactgacacgctactcctcctaatcggctca
gccctcgtccttttgatgacaccggggctagcctttttctatggcggttttggcagagcc
cagaacgtcctaaatatcatgatgatgagcttcttgatgatggggctcgtcggcatgact
tgggtgatttatggctacagtctcgctttcgacaccagtttagggagtccctttatcggc
ggttttagtaacctgtttttcaatggtgtcggtggcaagtttggcattgatcctgtctgg
gccggcgatgagttgatgatctccggtatgtctgcctccagctttgcgctgtttcaaggc
atgttcgcaatcattacgcccgctctgatttctggagcgctggtagagcgggtcaatttt
aaggcttggttctggttcggcttgctctggtccacgcttgtctacatccctatggcgcac
atggtctggggaagcaatggctttatctatggccagattggcgccctcgactttgccggc
agcaccgttgtccatattgcctctggggtgggtgccctagtgtccgtggcaatgatcggc
ccgcgtcgcgtcttcccgaatcgtctgtcgccgccgcacaatgtgccctttattttgttg
ggggcaggtctgctttggttcggctggtttggatttaacggcgcgagctacttcgctgcc
caaggcgccggttttgccttcctcaccaccaatacggcagcagcaacagccatgctgact
tggctattactcgagcagattgacctcgggaagcccaccgccgtaggcgccgcaaccggc
gcggtggctggtctagtcggaatcacaccgtctgctgggttcattcctgtttgggcggca
cttcccatcggtgccttgacagccctagtctgctttctgttcgtcgccaaagttaagagc
cggatccgactggatgattccctagatgcttttggggtacacggcgttggcggaaccgtc
ggcgctattctcacgggcatttttgcccagaaggatttcctcgttgagaaagctttccca
acccagttcaaggtgatctcccagggtcctttggccatgacttgggcacagatccaagcc
gtgttgattacctatctctttgttggcatcgctaccttcgtgatctggacgatcctgaaa
tcggtcatgcgtgtccgcgccacggaggaacaggagttggaagggctggactttgcccta
cacggcgaagatgcctacagcaaagagcgctag

DBGET integrated database retrieval system