KEGG   Synechococcus elongatus PCC6301: syc1828_d
Entry
syc1828_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
  KO
K01515  ADP-ribose pyrophosphatase [EC:3.6.1.13]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00230  Purine metabolism
syc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    syc1828_d
Enzymes [BR:syc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.13  ADP-ribose diphosphatase
     syc1828_d
SSDB
Motif
Pfam: NUDIX
Other DBs
NCBI-ProteinID: BAD80018
CyanoBase: syc1828_d
CYORF: syc1828_d
UniProt: A0A0H3K461
Position
1977432..1977983
AA seq 183 aa
MDRTPPEILRQTLSYRSRKFDFEVNQLRLPNQVEGEWACIRHPGGALAVPVLPDGRLVLV
RQYRFAAEGWLLEFPAGTVEDHEDPAATIAREIEEETGYRAGTWQHLGDFFLAPGYSDEV
IYAYLATDLEKLEHPPAGDEDEDIEVLALTPEELIAAIRDGEPVDAKTVTAFWLYQQLNS
AEL
NT seq 552 nt   +upstreamnt  +downstreamnt
atggatcgcaccccgccggaaattctgcgtcagaccctctcctatcgcagccgaaaattc
gactttgaagtgaatcaactgcgcctgcccaatcaagttgagggggaatgggcctgtatt
cggcatccaggcggggcgctagcggtaccagttttgccagatggtcgtttggtgctggtg
cgtcaatatcgctttgccgcagaaggttggctcttagaatttccagccggaaccgtcgaa
gatcatgaagatccagccgctacgatcgctcgcgaaattgaagaagaaacgggttatcgc
gctggcacgtggcaacacctcggagactttttccttgcaccaggctattccgatgaggtg
atttacgcctatcttgccactgacttagagaagctagaacatccgccggcgggagatgaa
gatgaagatattgaagtgttggctttgacccctgaagagttgatcgcagccattcgcgac
ggggagccagtcgatgcaaaaacggtgacggctttttggctttatcaacagctaaactca
gccgaattgtaa

DBGET integrated database retrieval system