KEGG   Synechococcus elongatus PCC6301: syc1829_d
Entry
syc1829_d         CDS       T00163                                 

Definition
(GenBank) glucanase
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Peptidase_M42 Peptidase_M28 Peptidase_M20
Other DBs
NCBI-ProteinID: BAD80019
CyanoBase: syc1829_d
CYORF: syc1829_d
UniProt: A0A0H3K7D9
Position
1978021..1979055
AA seq 344 aa
MMLDDWFAEIAALQACHSPSGWEGEIDTYLQQRFQAVGCSPEQDEAGNLIVRIEGDRPEV
IAVTAHKDEIGMIVEAIAPEGRVRVNRLGGSYPWIYGEGPVELLGDGAIVPGILSFGSRH
ISHASPQKALQVDKALTWPDTWIETKQSLEALQAAGVRPGTRVVVSRDRKRPQRLGQHIA
GYALDNKASLAILLDLAAQLKRPRYTVHLIASAKEEVGAVGALFHSQRQRLAALIALEII
PVAPEYPIAASEAPVLLSQDAYGLYDEDLNRALRQAAIAIDLPIQEAILQGFGSDGSIAM
KFGHVPRAACLGFATDNTHGYEIADLAAIAHCSRWLQQYLQPQQ
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgatgctggacgattggtttgctgaaattgcggcgctccaagcctgccattcgcccagt
ggttgggagggcgagattgacacttatctccagcagcgttttcaggctgtggggtgcagc
cctgagcaagatgaagcgggcaatctgattgtgcggattgaaggcgatcgcccggaggtg
attgcagtcacggctcacaaggacgaaatcggcatgattgtcgaggcgatcgcgccggag
ggtcgggtgcgggtcaatcgactgggcggctcctatccctggatttacggtgaagggccg
gtggagttgctgggcgatggcgcgatcgtgcctggcatccttagtttcgggtcgcgccat
atttcccacgcttcgccccaaaaagccttgcaggtagataaagcgctgacgtggcccgat
acatggattgagacgaaacagtcactggaagcattgcaagctgctggtgtacggcctgga
actcgcgtggtagtcagccgcgatcgcaaacgaccgcagcggctagggcaacacatcgcc
ggctatgccctcgacaacaaagcctcgctagccattctgctggatttggctgcgcagcta
aaacgaccgcgctacaccgttcatctgatcgcctcagccaaagaggaagttggtgcagtc
ggtgccctgttccatagtcaacgccagcggttagctgctttgattgcgctggaaatcatt
ccggttgcgccggaatacccgatcgctgccagtgaagcgccggttttgctctctcaagat
gcctatgggctctacgatgaagacctaaatcgagcgttacggcaggccgcgatcgcaatc
gatttgccaattcaagaagcgattctgcagggctttggtagcgacggctcgatcgccatg
aaatttggccatgttccccgtgccgcctgcctaggctttgccaccgataacacccatggc
tatgaaattgccgacctcgctgcgatcgcccactgtagtcgctggctgcagcagtacctc
cagccacagcagtag

DBGET integrated database retrieval system