KEGG   Synechococcus elongatus PCC6301: syc1830_d
Entry
syc1830_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DUF2232
Other DBs
NCBI-ProteinID: BAD80020
CyanoBase: syc1830_d
CYORF: syc1830_d
UniProt: A0A0H3K4J4
Position
1979084..1979821
AA seq 245 aa
MTAEPAKGPQAEDWDDWVDADPESATALTPAAIAARTEPQGPLALVETAFMASAAALLWL
VNYFFPLGPVLRVLFPLPIALLYRRWGLRSAWLGAIVASLLLFVLLGPTRGILFLLPPGC
LGVLLGCCWQRRLSWGWSILLGGGLETIGFFFRLWVLSVLLGEDIWTYVTAQATGFLEWL
TGVLGWLVQIPLSTVQAVAFAMITLSSLLYILVVHGVAWVLFRRLGTPIPAPPHWLQTVL
DLDAD
NT seq 738 nt   +upstreamnt  +downstreamnt
atgacagcagaaccggcgaaggggccgcaagcagaggattgggatgattgggtcgatgcg
gatccagagtcggcaacagcgctgacgcccgccgcgatcgcagcccgcacagaacctcaa
ggtcctctggcgctggtggaaaccgcgtttatggccagcgccgccgcactactgtggttg
gtcaattacttcttcccgctcggccctgtcctgcgagtcctgttcccgttaccgatcgcc
ttgctctaccgccgctggggtctacgcagcgcttggttaggcgcgatcgtcgccagtctg
ttgctgtttgttttgcttggcccgacgcgcggcattctcttcttgttgccgccgggctgt
ctgggggtcctcttgggttgctgttggcaacggcggctctcttggggttggtcgattctg
ctgggcggtggcctcgagacgatcggtttcttcttccgcctgtgggtgctgtccgtgctg
ttgggcgaagacatctggacctatgtgaccgcccaagccaccggctttctagagtggctg
acgggggtgctgggttggttagtccagataccgctctcgacggtgcaagcagtcgccttt
gcgatgatcaccctcagcagtttgctctacattctggtggtgcatggggtggcttgggtg
ctgttccgccgcttgggaacgcccatccccgcgccgccccattggctccagacggttctc
gatctcgatgcggactga

DBGET integrated database retrieval system