KEGG   Synechococcus elongatus PCC6301: syc1831_d
Entry
syc1831_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Other DBs
NCBI-ProteinID: BAD80021
CyanoBase: syc1831_d
CYORF: syc1831_d
UniProt: A0A0H3KAZ5
Position
1979811..1980956
AA seq 381 aa
MRTDAIACWGGEAQLFPWLTQVQGRSPLLAVLLAFTETALIPGISAAGKTPRDRRYTAHA
DAEFLYNGPNPQPQYPLPPLQAGASPVLITRACVEQLATPLFLIDAGLTQPLPVPAIRLN
SQPARCLSTGQAMPIAIAQQLFQQGQAHGAAIAAQHPDRWLVLGECVVGGTSTALALLLA
LGIEAAGCVSSSHPTCNHGQKLALVQQGLAAIPDRPARSPLELAAAIADPMLIAAAGMAM
AVSQTQSVLLAGGTQMLAAYALMAAIAQTGVAWQPDRIAVGTTRWVMVDPSAQVAQLGPA
IASRFGWEPLLLSTQLNFQRSRHAQLQVYEQGFVKEGVAAGGMAIAASLATGASVETLRQ
WVDDLGDRAIAASGIASAVTD
NT seq 1146 nt   +upstreamnt  +downstreamnt
atgcggactgacgcgatcgcctgctggggcggtgaggcccaactgtttccttggctcaca
caagtccaggggcgatcgcccttgctggccgtcctgctggcattcaccgagacggcgttg
attccaggcatttctgctgccggtaaaacccctcgcgatcgccgctacactgcccatgct
gatgctgagtttctctacaacggcccgaatccacagcctcaatacccgctgcctccgcta
caggcaggagcatcaccggtcttgatcacacgggcctgtgtggaacagttggccacacca
ctgtttttaattgatgctggcctcacgcaaccactcccagtccctgcaattcgcctcaac
agtcagccagctcgctgcctcagtacggggcaggccatgccgatcgcgatcgctcaacaa
ctgttccagcaaggacaagcccacggggctgcgatcgcggctcaacatcccgatcgctgg
ttggttctcggggaatgcgtcgtcggtggcaccagtacggccttggcattgctgttggct
ttaggcattgaagcggcaggctgtgttagtagcagccatcccacttgtaaccacgggcaa
aaattagctctcgtgcagcagggtctagcggcaattcccgatcgcccagcgcgatcacct
ctagagctggcagcagcaatcgctgatcccatgttgattgcggcggcaggaatggccatg
gccgtcagtcagacccagtcagtgctcttggctggcggtactcaaatgctggccgcttac
gccttgatggctgcaatcgcccagactggtgtggcatggcaacccgatcgcattgcggtg
ggaacaactcgctgggtgatggtcgatccgagtgctcaggtggcacagttaggccccgcg
atcgcttcacgattcggttgggaaccgttattgctctccacccagctcaacttccagcga
tcgcgtcatgctcagctgcaggtctatgagcaggggtttgtcaaagaaggggtggctgca
ggaggcatggcgatcgcagctagcttggccactggtgccagtgtcgaaaccctcaggcag
tgggttgatgacttgggcgatcgcgcaatcgcggctagcggtattgcaagtgcggtgact
gattga

DBGET integrated database retrieval system