KEGG   Synechococcus elongatus PCC6301: syc1834_d
Entry
syc1834_d         CDS       T00163                                 

Definition
(GenBank) transcriptional regulator
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: GerE HTH_23 Sigma70_r4_2 HTH_11 Sigma70_ECF Sigma70_r4 HTH_38 HTH_20 HTH_29 HTH_10 HTH_24 HTH_28 HTH_40 HTH_7 HTH_30 HTH_17 HTH_5 HTH_3 HTH_Tnp_4
Other DBs
NCBI-ProteinID: BAD80024
CyanoBase: syc1834_d
CYORF: syc1834_d
UniProt: A0A0H3K466
Position
1984099..1984374
AA seq 91 aa
MTASGEFPVSGALSERELQIVDLVAAGLTNQEIATRLDISKRTVDNHISNILTKTGTDNR
VALVRWALQWGKVCLDQVNCCILPDRDVAAS
NT seq 276 nt   +upstreamnt  +downstreamnt
atgacggcaagtggtgaatttcccgtcagcggtgcgctttctgagcgcgagctccaaatc
gtggatctcgtggcggctgggctgacgaatcaggaaattgccacgcggctggatatcagc
aagcggacggtcgacaaccacatcagcaacatcctcaccaaaaccgggaccgacaatcgg
gttgccttggtgcgctgggccttgcaatggggtaaagtctgcctcgatcaggtcaattgc
tgcattctgcccgatcgcgatgtggcggcctcctag

DBGET integrated database retrieval system