KEGG   Synechococcus elongatus PCC6301: syc1839_c
Entry
syc1839_c         CDS       T00163                                 

Gene name
rimM
Definition
(GenBank) 16S rRNA processing protein RimM
  KO
K02860  16S rRNA processing protein RimM
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:syc03009]
    syc1839_c (rimM)
Ribosome biogenesis [BR:syc03009]
 Prokaryotic type
  ribosomal protein modification factors
   syc1839_c (rimM)
SSDB
Motif
Pfam: RimM PRC
Other DBs
NCBI-ProteinID: BAD80029
CyanoBase: syc1839_c
CYORF: syc1839_c
UniProt: Q5N0Z1
Position
complement(1988180..1988728)
AA seq 182 aa
MSESTTTIETAWLAIGQIVAPQGLRGEMRVNPSSDFPERFLIPGPRWLRRPRQTEPEVVE
LERGRAIAGKNLYIVQLAGITSREQAEALRGCELLVPASDRPELDEGEFHVLDLIDLSVI
DQASSTPLGIVRDVVSAGNDLLVVELTDGREVYIPFVEAIVPVVDLAQGRIEITPPPGLL
EL
NT seq 549 nt   +upstreamnt  +downstreamnt
atgtctgaatcaacaacaaccatcgaaaccgcttggctggcgatcgggcaaattgtggcc
ccccaaggtctgcgcggcgaaatgcgggtcaacccgagcagtgattttcctgagcgcttc
ctcattcctggcccgcgctggctgcgtcgaccccgtcagactgagcccgaagtggtggag
ctggagcgcgggcgcgcgatcgccggcaaaaatctctacatcgtgcaactggccggaatc
accagccgagagcaggctgaagcattgcgcggttgtgagttgcttgtacctgccagcgat
cgccccgaactcgacgagggagaatttcacgtcttggatttgattgatctcagcgtgatt
gaccaagccagcagcacgcccctcggcatcgttcgcgatgtcgtcagcgcgggtaacgat
ctactggttgtggaactcacggatgggcgcgaggtctacattccctttgtggaggcgatc
gtcccagtggttgatctggcgcaaggccggattgaaatcacaccaccgccagggctgctt
gagctttag

DBGET integrated database retrieval system