KEGG   Synechococcus elongatus PCC6301: syc1840_c
Entry
syc1840_c         CDS       T00163                                 

Definition
(GenBank) valine-pyruvate aminotransferase
  KO
K00835  valine--pyruvate aminotransferase [EC:2.6.1.66]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00290  Valine, leucine and isoleucine biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    syc1840_c
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:syc01007]
    syc1840_c
Enzymes [BR:syc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.66  valine---pyruvate transaminase
     syc1840_c
Amino acid related enzymes [BR:syc01007]
 Aminotransferase (transaminase)
  Class I
   syc1840_c
SSDB
Motif
Pfam: Aminotran_1_2 Aminotran_MocR
Other DBs
NCBI-ProteinID: BAD80030
CyanoBase: syc1840_c
CYORF: syc1840_c
UniProt: A0A0H3K3W2
Position
complement(1988732..1990015)
AA seq 427 aa
MSLESLSRYGRQMSQLTGVRAIMKDIIETLRSGQGQTFINLSAGNPVVLPEVEQLWRDCT
ADLLGSAEYGQVVGRYGTSQGYEPLIAAIIQEFNQRYGWSISDRNILITPGSQSLYFLAA
NAFGGWAEDGSLRKILLPLSPDYTGYGGVCLEPQAVVAARPQIERIGDHRFKYRPDFEQL
QIGADTGMLLFSRPCNPTGNVISDAELERLATLAAAQNVPVFVDSAYAPPFPGLNFTEMT
PFFGDNIVHCLSLSKAGLPGERLGIAIGPEPVIQVLEAFQTNLCIHSSRYGQAIAARAIA
SGQLTAIAETVIRPYYAAKFARVERQLDALLPDSLPWRLHQGEGGIFAWLWLEEAPLDDW
QIYQQLKQAGVIVVPGSSFFPGLREDWVHTRQCLRISLAAEDHELETGMERLATTVQQIY
RQAPIPA
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgtccctagaatcgctcagccgctacgggcggcagatgtctcagctcacgggcgtacgc
gccatcatgaaggacatcattgagaccttgcgatcggggcaaggccaaacttttatcaat
ctcagtgctggaaatcccgtcgttctgcctgaggtggagcagctctggcgcgactgtacc
gccgatttactcggcagtgctgaatacggtcaggtggtgggtcgctacggcaccagtcaa
ggctatgaaccgctgatcgccgccatcattcaagagttcaatcagcgctacggctggtcg
attagcgatcgcaatattttgattacgcccggtagccagtctctctacttcttggcggcc
aatgcctttggtggctgggcagaagatggcagccttcgcaaaattctcttgccccttagc
cccgactataccggctacggtggcgtctgtctggaaccgcaggcggtggttgcggctcga
ccacagattgaacgaattggcgatcatcgcttcaaataccgtcctgactttgaacagttg
caaattggcgccgataccgggatgctgctgttttcgcggccctgcaatcccaccggcaac
gtcatcagtgacgccgaactagagcgtctggcgacccttgcggcagcccagaacgtgccg
gtgtttgtcgactctgcctacgcccccccctttcctgggctcaactttacggagatgacc
cccttctttggggacaacattgttcactgcctcagcctctcgaaggcgggtctgcctggt
gaacgcctcggcatcgccattggtccagagccggtgattcaagtcttggaagccttccag
accaatctttgcattcactcctcacgctatggccaagcaatcgcagcccgggcgatcgcc
tcaggccagttgacggcgatcgcagaaaccgtgattcgcccctactacgccgcaaaattt
gcccgagtcgaacgtcagctcgatgccctcttgccggattctttaccctggcgcttgcac
caaggagaaggtggcatttttgcttggctctggttagaagaagcccccctagatgattgg
caaatctatcagcagctcaaacaagcgggcgtaattgtcgtgccagggagttctttcttc
ccggggctgcgggaggattgggtccatacgcgccaatgtctgcggatcagcttggcagct
gaagatcacgaattggagaccggcatggaacgcctcgccaccactgtgcagcagatctat
cgtcaagcgcccattcccgcctaa

DBGET integrated database retrieval system