KEGG   Synechococcus elongatus PCC6301: syc1842_d
Entry
syc1842_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DUF1400
Other DBs
NCBI-ProteinID: BAD80032
CyanoBase: syc1842_d
CYORF: syc1842_d
UniProt: A0A0H3K7F1
Position
1990413..1990967
AA seq 184 aa
MPLFTFLSPKLRDFRQYLRIWAWFFLSLSLSFGSAKTAIAAERVTLLAGSWARSVELDDL
RSLAVTGQASGFLQDALRYGNLQPKTVQAALNFSIPLSPVLADRLLYSPLGNLALDRIGR
ILSPRVSGQDGRQALRGAILQSVARDSRFTLLELLDNYPTDARLDLLQIQQLQQDLALLS
RLSF
NT seq 555 nt   +upstreamnt  +downstreamnt
atgcctctgttcactttcctatcccccaagctcagggacttccgtcaatatctgcgtatc
tgggcctggtttttcttgagtctttcccttagttttggctcggcgaaaacggcgattgca
gcggagcgggtaaccctgttggctggttcctgggcgcgatcggtcgagctagatgatctg
cgatcgctcgcagttactggacaagcctcggggtttttgcaagatgctctccgctatggc
aacctccagcccaagactgtgcaagcggcgcttaatttctcaattccgctctcaccagtg
cttgccgatcgcttactctattcgccccttggtaatctggctttagatcgcatcggccga
attctgtcccctcgagtgtcgggccaagatggccgccaagccttgcggggagcaatttta
cagtcagtagcccgcgatagtcgtttcacgttgctcgagttgctggataactatccgacc
gatgcgcgcctcgatttactgcaaattcaacagttgcagcaggatttagcactgctcagt
cggctctcattctga

DBGET integrated database retrieval system