KEGG   Synechococcus elongatus PCC6301: syc1843_c
Entry
syc1843_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: AbrB-like
Other DBs
NCBI-ProteinID: BAD80033
CyanoBase: syc1843_c
CYORF: syc1843_c
UniProt: A0A0H3K4K3
Position
complement(1991104..1991508)
AA seq 134 aa
MPKKAIPNQPLTGEALLQRVRELQDASKDQKARACGYVTITKNGRERVNSLQFLNALLEA
QGITLDNELKLGRGRTGRSPSFRVSVQDNGNLLVGAAYTRKMGAKPGDAFTISLGRKQIK
LQKVSEDGSEDTEE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgcccaaaaaagcaattcctaaccaacccttgacgggtgaagcattactacaacgagtc
cgtgagctccaagatgcgagcaaggatcaaaaagcacgggcttgcggttatgtgacgatc
acgaagaacggtcgtgagcgagtcaattccttgcagttcctcaacgccttgctggaagcc
caggggattacgctcgacaacgaactcaagttaggccgtggccgtacgggtcggagtccg
agcttccgagtgagcgtgcaagataacggcaatctactcgttggggctgcctacacccgc
aaaatgggggctaagccaggcgatgcctttaccatcagccttggacgtaagcaaatcaag
ctccaaaaagtctcggaagatggttctgaagataccgaagagtag

DBGET integrated database retrieval system