KEGG   Synechococcus elongatus PCC6301: syc1844_d
Entry
syc1844_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DUF3370
Other DBs
NCBI-ProteinID: BAD80034
CyanoBase: syc1844_d
CYORF: syc1844_d
UniProt: A0A0H3KB09
Position
1992271..1993629
AA seq 452 aa
MRRLLPRCFSVLALSLLSSLTASIAIAQTIPIQSPVRRLEGQFNTTPVPHSNQPEIVQSE
GILIDTGPGFVRVTGSDLNRVPPHLQTIANPTYAFNGPFGLHLHHVYRPSDTTKFGGTRD
RGLLYVGVIATNFSDRPVRLGFQEGSLNTSFESPFFTQTLGVFSNSRWNYKSGPGDAAAL
SLLTGKRDWRLPAGLVLPPRSRSLLFSLPIAARGSATVLARGVSDGPVHLAVVATDHNPD
PDAFFSVLDRRLLAEGRTYLADLLRIQQRQVFSRVGGVAQGDRYEANLEADLQQPLHVPL
TTTWRKHFGTQELQANSLLTRMPDSALENIGTYGVEYVLNFRLRGQGLQRLLFSTLPEPK
DFLAFRGTLRIDFQGQTDYVHLSQRSGSTDTLYQFQMPPSGQADLRVSLVYPPDSTPGHL
LSIVPEVEYARLLPSPLPISPALSSQRLLSFP
NT seq 1359 nt   +upstreamnt  +downstreamnt
atgcgccggttacttcctcgctgcttttcggttctcgcgctgtccttgctctcatcgctg
acagcttcaattgcgatcgcccaaacgattcctatccaaagcccagttcgtcgcctagaa
ggacagttcaacaccactcccgtcccccattccaatcagcccgagatcgtgcagtccgag
ggaattctgattgatacagggcctggttttgtgcgggttactggatcagatttgaatcgc
gtaccgcctcatctgcagacgattgccaatcccacctatgcctttaacgggccgtttggg
ctgcatctgcaccatgtctatcgccccagtgacaccacaaaattcggtggcacgcgcgat
cgcggcttactctacgttggggtaatcgccacgaatttcagcgatcggccggtgcgcctt
ggttttcaggaaggcagcctcaatacctcctttgaaagtcctttctttacccaaaccttg
ggtgttttttcgaacagtcgctggaactataagtccggccccggtgatgcggccgccctc
tccttgctgaccggcaaacgagactggcgcctacccgctggactggtgctgccaccgcga
tcgcgcagtctactcttctccctaccgatcgcggctcgcggttcggcaaccgtgctggca
cggggcgttagcgacggtcctgtacacctcgcggtagttgctaccgatcacaacccggat
cctgacgcctttttctcagtactcgatcgccgactgctggccgagggcagaacctacttg
gctgatctgctccggattcaacaacgtcaagttttcagtcgcgtcgggggtgtggcccag
ggcgatcgctacgaggctaatctagaagcggatctgcaacagccgctccatgtgccactg
accaccacgtggcggaaacacttcggtacccaggaactgcaggccaactcactcctgact
cggatgcccgattcggcgctcgaaaacattggcacctacggtgtggaatacgtcctcaac
ttccgcttacggggccaaggcttgcagcgtttgttgttcagcacactgccggagcccaag
gattttctggccttccgggggacgctccgcattgattttcaagggcagactgactatgtc
catctcagtcagcgatcaggtagtactgataccctctatcagttccagatgccgccgtct
ggccaagccgatctgcgggtgagcctggtctatccgccggattcgacccccgggcacttg
ctcagcattgtgcccgaggttgagtacgcccgcttgctgcccagtcccttacccattagc
ccagccctcagttctcaacggctcctgtcgttcccctaa

DBGET integrated database retrieval system