KEGG   Synechococcus elongatus PCC6301: syc1845_d
Entry
syc1845_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: GCS2 PEP-utilisers_N CRISPR_Cse2
Other DBs
NCBI-ProteinID: BAD80035
CyanoBase: syc1845_d
CYORF: syc1845_d
UniProt: A0A0H3K3W6
Position
1993747..1994883
AA seq 378 aa
MQLTKGFEVEVYTGTPSGQVVGLSDRICSDLQGFMREPDSRNVEYTTPPRPCYDRLLLDL
LEPRRRLRAYLQQQGGYTLIPGSTLALSGGDHFYRSDPTNPYHDFIERSYGTTVVTASIH
INIGLSDPETILKACRLVRLEAPLYLALSASSPFLDGQVTGSHSTRWQLFPKTPPEVPLF
ESHAHFIRWTEAQLAAGSMQNVRHLWSSVRPNGDRHPYKINRLELRICDLVANPLDLLAI
TALLEARLQQLLEQPQLDPLIASRLTPDELVQLSDANEVAAARHSLDADLQHWQDGRTIA
ARDWIETLYETVFPLAKTRGYSCFLLPIQRLLQDGNLAQQWLRQVAAGATPEAAMVQAIA
ATAAEEQELADKLYGVAC
NT seq 1137 nt   +upstreamnt  +downstreamnt
gtgcagctgacaaaaggatttgaagttgaagtctacacaggtacgccgtctgggcaagtt
gtcggactttccgatcgcatctgtagcgatttgcagggttttatgcgggaacccgacagc
cgtaatgtcgaatacaccacgccgccacgaccctgctatgaccgactgctcttagatctt
ttggaaccgcggcgtcgcctgcgtgcctatctccagcagcagggcggctacacgctcatt
ccgggcagtacgctggcgctctctgggggcgatcacttctaccgctcggatcccaccaat
ccctaccacgacttcatcgaaaggtcctacggcactacggtcgtcaccgccagtattcac
atcaacattggcctgagcgatccagaaactattctcaaagcctgtcgattggttcggctc
gaagccccgctttatctggcgctcagtgcttcttcacccttcctcgatggccaagtcacg
ggttcccactcaacgcgctggcagctgttcccgaaaacaccgccggaagtgccgctgttt
gaaagccacgctcatttcattcgctggacggaagcgcagttagcggcgggcagcatgcaa
aatgttcgccatctctggagttcggtgcgccccaatggcgatcgccatccctacaagatc
aaccgactggaactgcggatctgcgatttagttgccaatcccttggatctcctggcgatt
acagctctgctagaagctcggctgcagcagctgttggaacagccgcaactcgaccccctg
attgccagccggctgacgcctgatgaattggtgcaactgagtgatgccaatgaggtagca
gcagcccgccacagcctcgatgccgatctgcagcactggcaagatggccgcacgatcgcg
gctcgcgactggattgaaacgctctatgagacagtgttccccctggctaaaactcggggt
tatagctgtttcttgctgccgattcagcgtcttttgcaggacggtaatcttgcccagcag
tggttgcggcaggttgctgccggagcaaccccagaagctgctatggtccaggcgatcgca
gcgacggcggccgaagaacaggaactcgccgataaactctacggggttgcctgttaa

DBGET integrated database retrieval system