KEGG   Synechococcus elongatus PCC6301: syc1848_d
Entry
syc1848_d         CDS       T00163                                 

Gene name
recF
Definition
(GenBank) DNA replication and repair protein RecF
  KO
K03629  DNA replication and repair protein RecF
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:syc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    syc1848_d (recF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:syc03400]
    syc1848_d (recF)
DNA repair and recombination proteins [BR:syc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     syc1848_d (recF)
SSDB
Motif
Pfam: SMC_N AAA_23 AAA_15 AAA_21 DUF2813 AAA_27 NB-ARC AAA_29 IML1
Other DBs
NCBI-ProteinID: BAD80038
CyanoBase: syc1848_d
CYORF: syc1848_d
UniProt: Q5N0Y2
Position
1998790..1999953
AA seq 387 aa
MFLHSLHLQHFRNYRDQTVQFQAPKTILLGENAQGKTNLLEAVELFSTLRSHRVSRDRDL
VQTGAESALLTAVVERDSGEQQLQIQLQQQGRRRVQRDGEVLRRQLDLLGSLCSVQFSSL
DLDLVRGGPQQRRVWLDRLLIQLQPIYAHLQQQYGRVLRQRNALLRRAESLDLALLAPLN
WQLAQLGVHIMRRRSRAIQRLVPLAAHWHREISGQREQLIVAYQPSVLAPDDTDEAIAWQ
ERMLAQIEARRAAELGQRTSLVGPHRDDLNLSINGTEARLQASQGQQRTLVLSLKLAELE
LIEAVLGEPPLLLLDDVLAELDLRRQQQLLEAIANRFQTLITTTHLSAFDQSWVETAQIL
TVQSGHLQSEAVPMAPSSASLHKSLDS
NT seq 1164 nt   +upstreamnt  +downstreamnt
atgtttttgcatagccttcaccttcaacactttcgcaactatcgcgatcaaacggtgcag
ttccaagctccaaagacaatcctgctcggcgaaaacgcccagggcaaaaccaatctgctg
gaagccgttgaactgttctcaaccctgcgatcgcatcgggtcagtcgcgatcgcgatttg
gttcagaccggagctgagtcagcgcttctaacagcggttgttgagcgcgacagcggcgag
caacagttgcaaattcagcttcaacaacaaggtcggcggcgggttcagcgagatggcgaa
gtcctacggcgacagcttgatctgctgggctcgctctgcagcgttcaattttcctccctt
gacctggacttggtacgaggggggccccagcaacgccgtgtctggctcgatcgcctgctg
attcaactccagccgatctatgcccatctgcaacagcaatacgggcgcgtgttgcggcag
cgcaatgccctgctgaggcgggcagagtctctcgatctggcactgctggcgccactcaac
tggcaactagctcagctcggtgtccacatcatgcggcggcgatcgcgagcaattcaacgc
cttgtgcccttggctgcccattggcacagggaaattagtggtcaacgggagcaactgatc
gtggcctatcagcccagtgtgctggcccccgacgacaccgatgaggcgatcgcgtggcaa
gaacgaatgctggcgcagatcgaggctcggcgggcggcggaattaggtcaacgcaccagt
ctggttggcccccatcgtgatgacctcaatctcagcatcaacggtactgaagcccggctt
caagcatcccaagggcagcagcgcaccttagtgctgtcgctcaagttggcggagctggag
ttgatcgaagcagtattgggcgagccgcccctgctgttgctggatgatgtcttagcagaa
ctggaccttcggcgacagcaacaattactagaagcgatcgccaaccgttttcagacgctg
attacaaccacgcatctttcggcctttgaccaaagctgggtggagaccgctcaaatcctt
acggtgcagtcgggtcatttgcagtctgaagcggtgccgatggccccaagcagcgcgtcc
ctgcataagtccctggatagttaa

DBGET integrated database retrieval system