KEGG   Synechococcus elongatus PCC6301: syc1850_d
Entry
syc1850_d         CDS       T00163                                 

Gene name
himA
Definition
(GenBank) DNA binding protein HU
  KO
K03530  DNA-binding protein HU-beta
Organism
syc  Synechococcus elongatus PCC6301
Brite
KEGG Orthology (KO) [BR:syc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:syc03032]
    syc1850_d (himA)
   03036 Chromosome and associated proteins [BR:syc03036]
    syc1850_d (himA)
   03400 DNA repair and recombination proteins [BR:syc03400]
    syc1850_d (himA)
DNA replication proteins [BR:syc03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    syc1850_d (himA)
Chromosome and associated proteins [BR:syc03036]
 Prokaryotic type
  Nucleoid associated proteins
   HU (heat unstable protein)
    syc1850_d (himA)
DNA repair and recombination proteins [BR:syc03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Supressor
      syc1850_d (himA)
SSDB
Motif
Pfam: Bac_DNA_binding HU-HIG HU-CCDC81_euk_1
Other DBs
NCBI-ProteinID: BAD80040
CyanoBase: syc1850_d
CYORF: syc1850_d
UniProt: A0A0H3K4K7
Position
2001301..2001576
AA seq 91 aa
MNKGELIDQVAVRTGLTKVQVAAAIDALVDVIVDTVVEGEKVSILGFGAFEARERSERQG
LNPKTGDKILIPAKKVPAFTAGKLFKDRVQG
NT seq 276 nt   +upstreamnt  +downstreamnt
atgaataagggtgaactcatcgatcaggtggcagtacggactggcctgactaaagtgcaa
gttgctgccgcgattgatgctttggtcgacgttattgtcgataccgtagtcgaaggtgaa
aaagtgtccattctgggctttggagccttcgaagcgcgcgagcgctccgagcgtcagggc
ctcaatcccaaaactggcgacaaaatcttgatccctgctaaaaaagttcctgctttcact
gctggcaagcttttcaaagatcgcgtccaaggctaa

DBGET integrated database retrieval system