KEGG   Synechococcus elongatus PCC6301: syc1851_c
Entry
syc1851_c         CDS       T00163                                 

Gene name
mutS
Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:syc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    syc1851_c (mutS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:syc03400]
    syc1851_c (mutS)
DNA repair and recombination proteins [BR:syc03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     syc1851_c (mutS)
SSDB
Motif
Pfam: MutS_V MutS_III MutS_I MutS_IV MutS_II
Other DBs
NCBI-ProteinID: BAD80041
CyanoBase: syc1851_c
CYORF: syc1851_c
UniProt: Q5N0X9
Position
complement(2002070..2004718)
AA seq 882 aa
MTTSELPEHLAKHEVRYADHRQVERDRLTPMMQHYAEVKDQHLQQILLYRMGDFFECFFQ
DAIVVARELELVLTSKEAGKEVGRVPMAGIPYHALDRYASQLVEKGYAIAICDQVETAAQ
AQGPLVRREITRIITPGTILEEGMLQARRNNFLAAVVIAGEHWGLAYADSSTGDYWTSQS
TGLEGLTQELYRLQPSEVLFPSAAPDLAGLLRPGQSKPQQIPDCLPDSFCYALRSPMPFE
LHEARQRLLEHFQLRSLEGCGCEQLPLAIRAAGGLLDYLGETQRESLAPLQKPRTYSLSE
FLILDQQTRRNLEITQTQRDGSFHGSLLWALDRTMTSMGGRLLRRWLLQPLLNPEAIRNR
QAAIQELCQDGRLRQDLRSLLQKIYDLERLSGRAGAGTANARDLLALAESLLRLPELAQL
LSRAQSPLLAQLQQVPPELEQLGDRLQQHLVESPPLQLTEGGLIRSGVAIALDELRQQVE
SDRQWIASLEASERTATGINSLKVGYSKTFGYFISLSRSKADQVPDHYIRRQTLTNEERF
ITPDLKERESRILNAQTDLNQLEYDLFVGLRSEVSHHVETIRAIATAVAAADVLAALAEV
AVYQNYCCPEIRDDRQLAIQDGRHPVVEQALPSGFYVPNSCGLGSDRGPDLIVLTGPNAS
GKSCYLRQVGLIQLLAQIGSFVPAKNAQVGICDRIFTRVGAVDDLATGQSTFMVEMDETA
NILNHATARSLVLLDEIGRGTATFDGLSIAWAVAEYLAREIQARTIFATHYHELNELSGL
LKNVANFQVTVKELPDRIVFLHQVQPGGADRSYGIEAARLAGLPSEVIDRAREVMSRIEK
HSRIAVGLRRGNGSQRRTQASPQQIDATIATEQLGLFSGPSH
NT seq 2649 nt   +upstreamnt  +downstreamnt
atgacaacttctgagcttccggagcatttggctaagcacgaggtgcgctatgccgatcac
cgtcaggtggagcgcgatcgcctgacgccgatgatgcagcactacgccgaggtcaaggat
cagcatctgcagcagatcctgctctatcggatgggcgactttttcgagtgcttctttcag
gatgcgatcgtggttgcccgcgagctagagctggtgttgaccagcaaggaagcagggaaa
gaagtcgggcgtgtgccgatggcgggcattccctatcacgccctcgatcgctatgccagc
cagttagttgagaagggttacgcgatcgcgatctgcgatcaggtagaaacggctgctcag
gcgcaagggccgctcgtccgccgcgaaatcacgcggatcatcacaccgggcaccatcctc
gaagagggaatgctgcaggcacgccgcaataactttttggcagcggtcgtgatcgccggc
gagcattgggggctggcctacgcagatagctccactggtgactattggacgagccaaagt
actggtctggagggactgacccaggagctctatcgcctgcaaccctcagaagtgctcttt
cccagtgccgcaccggatttagccggattgctgcggccggggcagtccaagccgcaacag
attcccgactgcttgccggattcgttttgctacgccctgcgatcgcccatgccctttgaa
ttgcatgaggcacggcagcggttgctggaacatttccaactgcgatcgctggaaggctgt
ggctgtgagcaattacccttggcgatccgtgctgctggtggtctcctggactacttggga
gaaacccagcgggaaagccttgcgccattacaaaagccgcgtacctattcgctgtcggag
tttttaatcctcgatcaacaaacccgccgcaatttagagatcactcaaactcagcgggat
ggcagcttccacggctcgctgctctgggcgctcgatcgcacgatgactagcatgggtggc
cgcctgttgcgccgctggttgctgcaacccttgctcaaccctgaggcgattcgcaaccgc
caagccgcgattcaagaactctgtcaggatgggcgacttcggcaggatctgcgatcgcta
ctccagaagatctacgaccttgagcggctctcaggccgcgctggtgctgggacggccaat
gcccgcgatctcttggcgctggcggagtcgttgctacgcctaccggagctggcccagtta
ctcagtcgtgcccaatcacccttgctggcgcaattacagcaggtgccaccggaactggag
cagttgggcgatcgcctccagcagcatttagtcgaatcgccccccttacaactgactgaa
ggcgggttgattcgatccggggttgcgatcgccttggatgagttgcggcaacaagtcgag
agcgatcgccagtggattgccagcctcgaagccagcgagcgtactgcgactggcatcaac
agcctcaaggtgggttacagcaaaaccttcggctatttcattagcctgagtcgtagcaaa
gccgatcaggtgcccgatcactacatccgccgccaaaccctgaccaacgaagagcgcttt
attacaccggatctaaaggagcgggaaagccgaatcctcaatgctcagacggatctcaat
caactggaatacgacctttttgttgggctgcgcagcgaagtcagtcaccatgtcgaaaca
atccgcgcgatcgccacagcagtcgctgccgctgatgtcttagcagctttagcggaggta
gcagtctaccaaaactattgctgccctgagattcgtgacgatcgccagttggcgattcag
gatggtcgccacccagtcgttgagcaggctttgccgagcggcttttatgtacccaatagt
tgcggcctcggtagcgatcgcggcccagatctaattgttttgaccgggccgaatgccagc
ggcaaaagttgttatttacgacaggttggcctcattcaactgctggctcaaattggtagt
tttgttcccgcgaagaatgcccaagttggaatttgcgatcgcatcttcacccgcgttgga
gccgtcgatgatctggcaactggccaatcaactttcatggtggagatggacgaaacggct
aacatcctcaaccatgccaccgcgcgatcgctggtcttgctggatgagattggtcgcggt
accgccacctttgatggcctctcgatcgcctgggctgtggcggaatatctagcaagggaa
atccaagcccgcacgatttttgcaacgcactaccacgagctgaatgagctgtcaggcctg
ctcaagaacgtcgccaacttccaagtcaccgttaaagaactgcccgatcgcattgtcttc
ctgcatcaagttcagccggggggcgccgatcgttcctatggcattgaagcagcgcggctc
gcaggtttacccagcgaggtgatcgatcgcgcccgtgaagtgatgagccgcattgaaaaa
cacagccgcattgctgtggggttacggcgtggcaatggtagccagcgtcggactcaggcg
tcgccccagcagatagatgccacgatcgctactgaacaattgggcctcttcagtggtcct
tcgcactaa

DBGET integrated database retrieval system