KEGG   Synechococcus elongatus PCC6301: syc1853_d
Entry
syc1853_d         CDS       T00163                                 

Definition
(GenBank) unknown protein
  KO
K02724  photosystem II PsbZ protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00195  Photosynthesis
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    syc1853_d
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:syc00194]
    syc1853_d
Photosynthesis proteins [BR:syc00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    syc1853_d
SSDB
Motif
Pfam: Ycf9 CEND1
Other DBs
NCBI-ProteinID: BAD80043
CyanoBase: syc1853_d
CYORF: syc1853_d
UniProt: Q5N0X7
Position
2006498..2006686
AA seq 62 aa
MVILFQLALLLLVVMSFVLIVGVPVLYATNGDRVQSNRLILVGGLAWTALVVLVGVLNYF
VV
NT seq 189 nt   +upstreamnt  +downstreamnt
atggtaatcctcttccaactggcactgctgttgctagtggtgatgtcctttgtgttgatt
gtgggcgtgccggtgctctacgccaccaatggcgatcgtgtccaatccaaccgcctgatc
ttggtgggtggcctcgcttggactgccctcgtggtgctcgtgggcgtcttgaactacttc
gtcgtttaa

DBGET integrated database retrieval system