KEGG   Synechococcus elongatus PCC6301: syc1854_d
Entry
syc1854_d         CDS       T00163                                 

Gene name
ribH
Definition
(GenBank) riboflavin synthase beta subunit
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00740  Riboflavin metabolism
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    syc1854_d (ribH)
Enzymes [BR:syc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     syc1854_d (ribH)
SSDB
Motif
Pfam: DMRL_synthase
Other DBs
NCBI-ProteinID: BAD80044
CyanoBase: syc1854_d
CYORF: syc1854_d
UniProt: Q5N0X6
Position
2006696..2007241
AA seq 181 aa
MAVFEGSFVNASQFRLAVVIGRFNDLVCEKLLAGCQDCLKRHGVDPDPQGTQVDYAWVPG
SFEIPLVARQLALTGRYDAIICLGAVIRGQTPHFDYVASEVAKGVAATSLQTGIPIAFGV
LTVDNLQQALERAGIKSNLGWNYALSALEMASLMHQIRSTTGEVPRQTLPLAAAPSNFAG
T
NT seq 546 nt   +upstreamnt  +downstreamnt
atggccgtttttgaaggcagttttgtcaatgccagtcagttccgactggccgtggtcatt
ggccggttcaatgatctcgtctgcgaaaagctcttggccggttgccaagactgcctcaag
cggcatggggttgatccagatccgcaaggaacgcaggtggattacgcctgggttccgggc
agtttcgagattcccctcgtggctcgccaattggccctcacgggtcgctacgatgcgatc
atctgtctaggtgcggtgattcgcggccaaaccccccactttgactacgtcgccagcgaa
gtcgctaaaggggtggcggcaaccagtctacaaaccggcatcccgatcgcctttggggtg
ctgacagtggataacctgcagcaggcgctagagcgagcaggcatcaagagcaacctcggc
tggaactacgccctcagtgcgctggagatggcgagccttatgcaccagatccgcagcacg
acgggagaggttcctcgccaaaccctgcctctggcggcggctccaagcaattttgccgga
acttaa

DBGET integrated database retrieval system