KEGG   Synechococcus elongatus PCC6301: syc1855_d
Entry
syc1855_d         CDS       T00163                                 

Gene name
proA
Definition
(GenBank) gamma-glutamyl phosphate reductase
  KO
K00147  glutamate-5-semialdehyde dehydrogenase [EC:1.2.1.41]
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc00330  Arginine and proline metabolism
syc00332  Carbapenem biosynthesis
syc01100  Metabolic pathways
syc01110  Biosynthesis of secondary metabolites
syc01230  Biosynthesis of amino acids
Module
syc_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:syc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    syc1855_d (proA)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    syc1855_d (proA)
Enzymes [BR:syc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     syc1855_d (proA)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: BAD80045
CyanoBase: syc1855_d
CYORF: syc1855_d
UniProt: A0A0H3K3X2
Position
2007532..2008776
AA seq 414 aa
MAAPARAFVYQAYQAANQLARTKPLVRSQALQAIAQAIDSARDGILEANTLDLEACQDSE
MPDLLRRWLKLTPERLDRTVEILERLSVRSDPIQQVMRASFQHEHSQAYSQLMPLGVIAF
VYEALPELAAIATGLCLRVGNSILLKGGTEAVHTNQAIVSVMQEALESTELPTTSLISLP
EDDPATSLAALVTQDQWIDLVIPYGRPELVQQVARLATSPVLRTSMGNCYLYWASGGELE
TVRWMILDSHASEPDAVNAIEKVLIDRDCNLSKLTVLMDSLRSKGFRLKGDEELVQEMPE
LELARHEDWSRPYLSRTVAFKLVPGIEAATDWINTHSSGHADSIVTDSYEDSRAFSRELN
SAMVHVNASPRFSRSPRHSNEIALGMSNQKGYRRGRITLETLTTIKQVVLGLGQ
NT seq 1245 nt   +upstreamnt  +downstreamnt
atggcagcacccgctcgggcatttgtctaccaggcttatcaagctgctaatcagttggca
cgcactaagcccctcgtgcgcagccaagcactccaagcgattgcccaagccatcgattcc
gcccgagacggcattctggaagctaatacgctggatttagaagcctgccaagatagcgag
atgccagacttgctgcggcgctggctgaagctgacccccgaacgactcgatcgcacggtc
gaaattttggaacgcctcagcgtgcgatccgatccgattcagcaggtgatgcgggcaagc
ttccagcatgaacatagtcaggcctacagtcagctgatgcccttgggtgtcatcgccttt
gtctatgaggcgctaccggaattggcggcgatcgcgacaggtctttgtctgcgcgtgggc
aatagcattctgctcaagggcggcactgaggccgtgcataccaatcaggcgatcgtctct
gtcatgcaagaggcgctggagtcgacggagctaccgacgacgagcttgatctcgctgccc
gaggatgatccagccacgagtctggcagcccttgtcacccaagatcagtggattgacttg
gtgattccctacggaaggcctgagttggtgcagcaggtggcacgcctcgcaacatcccct
gtgcttcgcaccagcatgggcaactgctacctctactgggctagtggcggtgagctagaa
acggtgcgctggatgatcttggatagccatgccagtgaaccggatgccgtcaacgcgatc
gaaaaagtgttgatcgatcgtgattgcaacctcagcaagctgacggtcttgatggatagc
ctgcgcagcaaaggttttaggctcaagggcgatgaggaacttgtgcaggaaatgccggag
ttggaactcgcccgccacgaagattggtcccgcccctacctcagtcgaaccgtggccttt
aagctcgtgcctggcatcgaagcggcaaccgactggatcaatacccacagcagcggccat
gccgacagtattgtcaccgactcctatgaagatagtcgtgctttcagccgcgaactgaac
agcgccatggtgcatgtcaatgcctcaccccgctttagccgtagcccgcgccacagtaac
gaaattgccctagggatgagcaatcaaaagggctatcgccgcggacggatcaccctagaa
accttgacgacgatcaagcaagttgttcttggtctggggcagtag

DBGET integrated database retrieval system