KEGG   Synechococcus elongatus PCC6301: syc1856_d
Entry
syc1856_d         CDS       T00163                                 

Definition
(GenBank) two-component sensor histidine kinase
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: HisKA HATPase_c
Other DBs
NCBI-ProteinID: BAD80046
CyanoBase: syc1856_d
CYORF: syc1856_d
UniProt: A0A0H3K483
Position
2008783..2009775
AA seq 330 aa
MASGWTLLAGFAGGLTIASLFQSIRDLSQPGIKETSTEAATGPELPRTPAALPDNELKQR
LLNSELQAALAQFQAGYLARAAHELRSPLSTLMSLNQLILADLCESPAEERVAVQRSQIA
ARRLLQLLDQLIVVSQWQSGRLPLRFEDLAIAPVLTRLQTVLQPIAAGRNLALHWPTDWS
TLPMVNSDRRALEHCLLHWLQAAIAAPGCTQIQLRIRAEQSDWWVEIDHDGPAWTDVANL
EQSLQGQGLSILIGQQLLDLLGGQLEFSTPESGSARLSLRLLGRLVPAIAASRGAPLLVA
QQTVAAADQQQEEGAVGHDPNAGYQQTPDE
NT seq 993 nt   +upstreamnt  +downstreamnt
atggccagtggctggactctgttggcaggttttgcaggtggtttgacaatcgccagcctt
tttcaaagtattcgtgacctgtctcaaccggggattaaggagacttctacggaagcagcc
acaggacccgagttgccccgcactccagctgcgctgcccgacaatgagctcaaacagcgc
ttactcaattcggagttgcaagcagcacttgctcagtttcaagctggttatctggcccga
gcggcccacgaactgcgatcgcccctcagtacgctgatgagcttgaatcagttgattctg
gcggatctgtgcgaaagccctgctgaagaacgggtggctgtgcagcgatcgcagatagcc
gcaagacgactgttgcaattactcgatcagttaattgttgtctcccaatggcagagcggt
cggctaccgttgcgctttgaagatctggcgatcgccccagtgttgacgcgactgcaaacg
gtgttgcaaccgatcgccgccggccgcaatcttgccctgcattggccgaccgattggtca
accctgccgatggtcaacagcgatcgccgagcgctagagcactgtctgctgcattggctg
caagccgcgatcgctgcgcctggttgtacgcagattcagctacgcatccgagcagagcag
tcggattggtgggttgagattgaccacgatggaccggcttggactgatgtggccaacctt
gagcaaagcctgcaaggtcaaggcctctcgatcttgatcggacagcagttgctcgacctg
ctgggagggcagctagaattcagcacccctgagtcgggctcggctcggctaagcctgcgg
ctgctggggcggttggtccctgcgatcgctgctagtcgtggtgctccgctgctggtagcg
caacagaccgtagccgccgccgatcaacagcaggaagagggggctgtaggccacgatcca
aacgccggctaccaacaaactccggatgagtag

DBGET integrated database retrieval system