KEGG   Synechococcus elongatus PCC6301: syc1857_c
Entry
syc1857_c         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DUF4349 GGN CENP-F_leu_zip DUF155 Baculo_PEP_C
Other DBs
NCBI-ProteinID: BAD80047
CyanoBase: syc1857_c
CYORF: syc1857_c
UniProt: A0A0H3K7G7
Position
complement(2009611..2010483)
AA seq 290 aa
MKRSLSLSLITLVATGSALLGGCTETSSSPASAPSVVPEAAANQAAEAPRANAPRPQLAK
TATMQLAVQDVPTAVRSAQAIVNREQGDILQQTESSGDSPSATLQARIPADRLETAIAAF
RALGRVDTVNVQAEDVARQLTDLQARLTNLERTERALQSILDRATKVEDVLKVTERLSST
REQIEQLKAEQLNLRTRVAYSTITLQFQSQILGETALPAFAPELETAWRQSSQSVLLLIR
SLLVAGVWIVAYSPLFLLLIGGGYGLLRYQQRSTTTSSDRRDQPPQQPQA
NT seq 873 nt   +upstreamnt  +downstreamnt
gtgaagcgttctctctccttgtctctgattaccttagtggcgacgggcagtgctctcttg
ggcggctgcactgaaaccagtagttcacctgcctcggcgcccagtgtggtgcccgaggca
gcagccaatcaagcagctgaggctccccgtgctaatgcccctcggccccaactcgctaag
acagccacgatgcaactggctgttcaagatgtgcccacagcggtacggtcggcgcaagcg
atcgtgaatcgagagcagggggacattttgcagcagaccgagtccagcggcgattccccc
agtgccaccctgcaggcgcggatccccgcagaccggttagagaccgcgatcgccgccttt
cgggctctcgggcgggtcgataccgtcaatgttcaagcggaggatgtcgcccgacagctc
acagatttacaagcccgactgaccaatttagagcgcaccgaacgggctcttcagagcatt
ctcgatcgcgctactaaggtggaagacgtgctcaaagtgaccgagcgactgagcagcacg
cgggaacaaatcgagcagctcaaagcagaacaactcaacctccgcactcgtgtcgcctat
tcaacgatcaccctgcaattccaatcgcaaatcctgggagaaacggccctaccagccttt
gccccagaactggagaccgcttggcgtcaatcctcgcagtcagtcttgctactcatccgg
agtttgttggtagccggcgtttggatcgtggcctacagccccctcttcctgctgttgatc
ggcggcggctacggtctgttgcgctaccagcagcggagcaccacgactagcagcgatcgc
agggaccaaccgccccagcagccgcaggcttag

DBGET integrated database retrieval system