KEGG   Synechococcus elongatus PCC6301: syc1858_c
Entry
syc1858_c         CDS       T00163                                 

Gene name
ycf52
Definition
(GenBank) hypothetical protein YCF52
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 PanZ Acetyltransf_9 Acetyltransf_CG FR47 NodA Acetyltransf_16
Other DBs
NCBI-ProteinID: BAD80048
CyanoBase: syc1858_c
CYORF: syc1858_c
UniProt: A0A0H3K4L1
Position
complement(2010538..2011068)
AA seq 176 aa
MSNSRVVYQIHTPEEFRGGHSAARRLDFEQLRRLFELTAFWGRDRSIEQLQIAVRNSEPV
VSAHIGDRLLGFARATSDGIYRATIWDVIVHPDFQGSGIGRKLVETVLSHPHVSHAERVY
LMTTHQQRFYEKVGFSVNSTTTMVLFNQELPVSCQTSDRSAEALALAEVVELPQTP
NT seq 531 nt   +upstreamnt  +downstreamnt
atgagcaacagccgtgttgtgtaccaaatccatactccagaggagtttcggggtggtcac
agtgcagcccgacgtttggactttgagcaactgcgccgcctgtttgaactgacggccttt
tggggccgcgatcgcagcattgaacaactccagattgcggttcgcaatagtgagccggtc
gtcagcgctcacattggcgatcgcctgcttggatttgcccgcgccacctccgatggcatc
tatcgcgccaccatttgggatgtgatcgtccatccagactttcaagggagcggcatcggt
cgcaagctggtcgagacggtactcagccacccccacgtcagccatgcggaacgggtctat
ctgatgaccacgcaccagcagcgcttttacgaaaaagtcggcttttcggtcaactccacc
accaccatggttctgttcaaccaagagctgcctgtctcctgtcagaccagcgatcgcagt
gctgaagcccttgcccttgcagaggttgtagaactgccacagaccccttag

DBGET integrated database retrieval system