KEGG   Synechococcus elongatus PCC6301: syc1859_d
Entry
syc1859_d         CDS       T00163                                 

Definition
(GenBank) hypothetical protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: DHC Cytochrome_CBB3
Other DBs
NCBI-ProteinID: BAD80049
CyanoBase: syc1859_d
CYORF: syc1859_d
UniProt: A0A0H3KB20
Position
2011238..2011753
AA seq 171 aa
MIAVAMPRRFSLLLFAIACTVCLLLGSGLERLQAATYVPVDTVDPIQPRYALGQQAYRES
CGSCHVALPPEVLPIQTWQILLNDTQHYGTILPAIDVPTQRLIGNYLRAYTRSLAVGETV
PYRLRNSVLFRSLHPQVNVPSTGQINSCISCHPAASQFSYRQLSPEWQSSR
NT seq 516 nt   +upstreamnt  +downstreamnt
atgattgctgtcgctatgcctcggcgtttttctctgttgttgtttgcgatcgcttgtacg
gtctgcttactgctcggcagtggcctagagcgtttgcaagccgcgacctatgtccctgtc
gatacagttgacccaatccaaccgcgctatgccttgggacagcaagcctatcgagaaagc
tgtggcagttgccatgtggcgttgccgccggaagtcttgccaatccaaacctggcaaatt
ttgctgaacgacacgcagcattacggcacgatattacctgccatcgatgtgccgactcag
cgactgatcgggaattacctacgggcttacacgcgatcgctcgcggtcggtgaaacagtc
ccctaccgtctccgcaattcagtgctgttccgatcgcttcacccccaggtgaatgtgccg
agtacaggacaaatcaatagttgcatcagctgccatccggccgcatctcaattttcctat
cggcaactctctcccgagtggcaaagcagccgctga

DBGET integrated database retrieval system