KEGG   Synechococcus elongatus PCC6301: syc1860_d
Entry
syc1860_d         CDS       T00163                                 

Gene name
glcP
Definition
(GenBank) glucose transport protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: Sugar_tr MFS_1
Other DBs
NCBI-ProteinID: BAD80050
CyanoBase: syc1860_d
CYORF: syc1860_d
UniProt: A0A0H3K3X7
Position
2011961..2013400
AA seq 479 aa
MVVSSHSAMSSSIAKSVQSHIDETPPRPLSSMQWQIWSLAAMGKLFEGMVIFITGVAVPL
IERDFNLSSALKGSVAAASLLGILIGASLFGNLADRYGRKFVFVIEMAIFTIAIALSAVA
WNVSALIFFLFCSGLALGADYPIAHIIVSESIPSRFRGRMVLGAFAFQSVGSLAGVLIGL
LVLRIYPEVGAWHWMYAALVIPSILVFLMRTKLPESPHWLVSRKQFELAHRAAKALLQRP
VAIAQNDSDGERQNPRLGYRRLLTPRYLRATVLTAVPWFLQDLATYGIGIFTPTILATLF
TKAQPNFVLQDMIATEGSGLIDLFLLVGFAASIPLVDKFGRIPLQIIGFIGCSVGLIIAS
LSAVSIPESHELRILFIFGGFILFNFMTNLGPNAMTYVLSGEVFPTEIRGVGAGFAASFA
KIGAVATAFFFPILREQIGTVALLCGLAVTSLLGALVTFLFRIEPNGHSLEELSEKPLV
NT seq 1440 nt   +upstreamnt  +downstreamnt
gtggttgtttcatctcactcggctatgagttcctccattgccaaaagtgttcagagccat
attgatgaaacgcctccccgtcctctgagctccatgcagtggcaaatctggagtttggcc
gcgatggggaagctatttgaaggcatggtgatttttattaccggtgtagctgttccattg
attgaaagagactttaatctctcttctgcactcaagggctctgttgcggcggcatctttg
ttgggaatcttgattggagcttccctgtttggcaacttggccgatcgctatgggcgaaag
tttgtcttcgtcattgagatggcaatttttacaattgcgatcgccctatccgctgtagct
tggaatgtctcggctttaattttctttctgttttgtagtggcttggccctaggggccgat
tatcctattgcccatattattgtgtctgaatcaattcccagccgatttcgtggccggatg
gtattgggagcctttgcctttcaatctgtgggatctctggctggtgtattgattggccta
ctggttttgcgaatttatccagaagtaggtgcttggcactggatgtatgcagctcttgtg
attccaagtatccttgtcttcctgatgagaactaaactaccagaaagtcctcactggttg
gtctctcgcaaacagtttgaactcgctcatcgggcggctaaagcattgctgcaacggcct
gtagcgatcgctcagaatgattccgatggggagcggcaaaatccccgactcggctacaga
agattattgacgcctcgatacctaagagcgacagttcttactgctgttccttggtttctt
caggatctagcaacctatggaattggaatttttacacctacgatattggcaacattattc
acaaaagctcagcctaactttgtccttcaagacatgattgccacagaaggttcaggcctt
atcgatctattcttgcttgtgggctttgctgcttctatcccgttggttgacaaatttggg
cgtatccccctgcagatcattggctttattggctgttcggttggactcatcattgcttct
ctgtcggcagtgagcatcccagaaagtcatgagctgaggattctcttcatttttggtgga
tttattcttttcaacttcatgactaatttggggccgaacgcaatgacctacgttttgtca
ggggaagtattccctacagaaatacgaggtgtcggagcgggctttgctgcttcttttgcc
aagattggtgcggttgccacagccttcttcttcccaatcctgcgtgagcaaattggaaca
gttgctctgctgtgtggtttggctgtcacatcgctcttgggtgcgctggtaacatttctc
tttcgaattgagcccaatggccacagtcttgaagaattaagcgagaagcctcttgtttag

DBGET integrated database retrieval system