KEGG   Synechococcus elongatus PCC6301: syc1861_d
Entry
syc1861_d         CDS       T00163                                 

Definition
(GenBank) unknown protein
Organism
syc  Synechococcus elongatus PCC6301
SSDB
Motif
Pfam: CbiG_C
Other DBs
NCBI-ProteinID: BAD80051
CyanoBase: syc1861_d
CYORF: syc1861_d
UniProt: A0A0H3K488
Position
2013542..2013976
AA seq 144 aa
MIFAERSLWIGIGFQQAATVADLQTAIAQACGQLSISRAAIAGLASLEHKLPSLTAIAQP
FHWELRGFSAAELAAIAVPHPCSRVAEQMQTASVAEAAALAAIQPQAGILLLPKRVFHLN
QTAITLAIAAPVPVQPGASIPSGL
NT seq 435 nt   +upstreamnt  +downstreamnt
atgatcttcgccgagcgatcgctctggataggcattggttttcagcaggcagcgacagtc
gcagacttgcagacagcgatcgctcaagcctgtggacaactatcgatttcgcgggcggca
atcgctggattagccagccttgagcacaagttgccctctttgacggcgatcgctcagcca
tttcactgggaactgcggggcttttcggcagcggaattagcagcgatcgcggtgcctcat
ccctgttctagagttgcagagcaaatgcaaactgctagcgtcgccgaagcggcagcttta
gcagcaattcaaccgcaggcagggattctcctgttaccgaagcgagtctttcacctgaat
cagaccgcaattaccctggcgatcgcggccccagtccccgtccagccgggtgctagcatc
ccgtcaggtctttga

DBGET integrated database retrieval system