KEGG   Synechococcus elongatus PCC6301: syc1862_d
Entry
syc1862_d         CDS       T00163                                 

Definition
(GenBank) ABC transporter ATP-binding protein
  KO
K02031  peptide/nickel transport system ATP-binding protein
K02032  peptide/nickel transport system ATP-binding protein
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:syc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    syc1862_d
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syc02000]
    syc1862_d
Transporters [BR:syc02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    syc1862_d
SSDB
Motif
Pfam: ABC_tran oligo_HPY SMC_N AAA_21 AAA_22 AAA_16 Mg_chelatase TniB RsgA_GTPase AAA_23 DUF3265
Other DBs
NCBI-ProteinID: BAD80052
CyanoBase: syc1862_d
CYORF: syc1862_d
UniProt: A0A0H3K7H5
Position
2013985..2015649
AA seq 554 aa
MADPLLEIRQLQICFGEAIALQGLDLVVQPGESVGIVGESGSGKSVACLAIPGLLPKTAR
CSGQIAFRSVAGQSSRDLLTLPERELRQLRGDRLGFIFQEPLSSLNPVFSAGFQLLEAIQ
QHLPLSQAEAQQRVIALLQEVQLIREPSQAAQILRRYPHQLSGGQRQRLMIAIALAANPD
LLLADEPTTALDATVQASVLQLLRRLQQQRQMAMIFVSHDLGVIAEVADRVVVLYRGQVV
EQGRVADVLNSPQHPYTQGLVACRPQINPRSCYLPTVADFLEGQTEPRSLPPRSPATQPL
LQVEQLGITYRGRSTAFQAVQNLSFTLPAGLTLGLVGESGCGKSSLARCLVGLVPASEGQ
IWLDQQPLDLRSSRDRQRLRQTVQMVFQDPAAALDPRWTVGSAILEPLRIKQPRRDRTAD
QRLLKQWLQRVDLPTDIGDRYPHEFSGGQRQRICIARALIGQPRLLICDESVSALDVSVQ
AQILNLLKQLQAELGLTYLFISHDLAVVRYMSDRILVMNQGQLEEDSPTEQLFQRPQSDY
TRRLIAAIPGEVAA
NT seq 1665 nt   +upstreamnt  +downstreamnt
atggctgatccgctcctagaaattcggcaattgcaaatctgctttggagaggcgatcgct
ctgcaaggattggatctggtggttcagcctggggaatctgtcggaattgttggcgaatcg
gggtctggtaaatcggttgcttgcttggccattccgggcttgttgcccaagacggcccgc
tgcagtggtcagattgcctttcgatcggtagcgggacaatccagtcgagatctcttgacg
ctaccagaacgcgagttgcgacagttgcggggcgatcgcctcggcttcatttttcaggag
ccgcttagctctctcaatccagtttttagcgccggttttcagctgctagaggccatccaa
cagcatttgcctttgagtcaggcggaagcccaacagcgagtgatcgcgctccttcaggaa
gttcagctgattcgcgagccgtctcaggctgcccagattctgcgacgctatccgcaccaa
ctatctggcgggcagcgtcaacgcttgatgattgcgatcgccctagcggccaatcccgac
ctcttgctggcagatgaaccgacgacagctctggatgccacggtgcaagcctcagtgctg
caactgttgcgccgcctgcagcagcaacggcagatggcgatgatttttgtcagtcatgac
cttggggtgattgccgaagtcgccgatcgcgtcgtggtgctctatcgcggccaggtcgtt
gagcaaggtcgagtggccgacgtcctgaattcccctcagcatccttacactcaggggctg
gtggcttgccgaccgcagatcaatccccgcagttgctatctccccaccgttgctgatttt
ctggaaggccaaaccgaaccgcgatcgctgccaccccgatcgccagccacccagccgctg
ttgcaggtcgagcagcttggcattacctatcgtggtcgtagtacggcttttcaggcggtg
caaaacctttcctttaccctgcccgccggtttgaccctaggactcgtgggcgagtcgggc
tgtggcaaaagtagcttggctcgctgtctcgtcgggttagttcctgcgagtgaggggcaa
atttggctcgatcaacagccgcttgatctgcgatcgtcgcgcgatcgccagcgacttcgc
cagacggtacaaatggtctttcaagatccggcggcagcccttgatccacgctggaccgtg
ggatccgcgattctagaacccttgcggatcaaacaaccgcgccgcgatcgcaccgctgat
caacgcctgcttaaacaatggttgcaacgggtcgatctgccgacagatatcggcgatcgc
tacccccacgagttttccggtggccagcggcagcgcatctgtattgcccgcgccctgatt
ggtcagccgcgcttgctaatttgtgatgaatcggtttcagcgctagatgtctcggtgcag
gcgcaaattctcaacttgctcaagcaactgcaggcggagctggggttgacctacctgttc
atctcccacgatctcgcggtggtgcgctacatgagcgatcgcattttggtgatgaatcag
ggtcagcttgaagaagatagcccaacggagcaactcttccagcggccgcaatcagactac
acgcgccgcctgattgcggctatccccggagaagtcgcagcttaa

DBGET integrated database retrieval system