KEGG   Synechococcus elongatus PCC6301: syc1871_d
Entry
syc1871_d         CDS       T00163                                 

Gene name
rps3
Definition
(GenBank) 30S ribosomal protein S3
  KO
K02982  small subunit ribosomal protein S3
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:syc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    syc1871_d (rps3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:syc03011]
    syc1871_d (rps3)
Ribosome [BR:syc03011]
 Ribosomal proteins
  Bacteria
   Small subunit
    syc1871_d (rps3)
  Archaea
    syc1871_d (rps3)
SSDB
Motif
Pfam: Ribosomal_S3_C KH_2 KH_4 DUF2379 DUF3126 APP_N
Other DBs
NCBI-ProteinID: BAD80061
CyanoBase: syc1871_d
CYORF: syc1871_d
UniProt: O24695
Position
2020721..2021455
AA seq 244 aa
MGQKINPVGFRLGVTQEHRSRWFADPNRYPQLLQEDKKIRDYVRKNLSNAGIADIRVERK
ADQVELEIRTARPGVVVGRGGAGIDTLREGLQALLKDSSRQIRINVIEVERVDADAALLG
EYIAQQLERRVAFRRCVRQAIQRAQRAGVQGIKIQVAGRLNGAEIARTEWTREGRVPLHT
LRADIDYAYTTATTTYGILGIKVWVFRGEIIPGQEDAAPSNVGQPRRRNQQRRRQQFEDR
SNEG
NT seq 735 nt   +upstreamnt  +downstreamnt
gtgggacagaaaattaatccagtcggattccgcctcggcgtcacccaagagcaccgctcc
cgttggttcgccgaccccaatcgttatccgcaactgctgcaagaagataaaaaaatccgc
gactacgttcgcaaaaacctgagcaatgctggcattgccgacattcgggttgaacggaaa
gccgatcaagttgagctggaaattcgtacggctcgtcctggcgtggtcgttggtcgtggt
ggcgctgggattgacaccctgcgtgagggtctgcaagcactgctgaaagactccagtcgc
caaattcgcatcaacgtcatcgaagttgagcgggttgatgccgatgcagccttgcttggt
gagtacatcgctcaacagctcgagcgtcgggttgctttccgccgctgtgtgcgtcaagcc
attcaacgggctcagcgcgctggcgttcaaggcatcaagattcaagtggctggccgcttg
aatggagcagaaattgctcggaccgagtggacgcgtgaaggtcgagtgccgctgcatacg
ctgcgagctgacatcgactacgcctacaccacggccaccacgacctacgggatcttgggg
attaaggtttgggtcttccggggtgaaattatccctggccaagaagacgcagcccccagt
aatgtcggtcagccgcgtcgtcgcaatcaacagcgccgtcgccagcagtttgaagatcgc
tctaacgaaggttaa

DBGET integrated database retrieval system