KEGG   Synechococcus elongatus PCC6301: syc1880_d
Entry
syc1880_d         CDS       T00163                                 

Gene name
rpl18
Definition
(GenBank) 50S ribosomal protein L18
  KO
K02881  large subunit ribosomal protein L18
Organism
syc  Synechococcus elongatus PCC6301
Pathway
syc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:syc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    syc1880_d (rpl18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:syc03011]
    syc1880_d (rpl18)
Ribosome [BR:syc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    syc1880_d (rpl18)
  Bacteria
    syc1880_d (rpl18)
  Archaea
    syc1880_d (rpl18)
SSDB
Motif
Pfam: Ribosomal_L18p RraA-like
Other DBs
NCBI-ProteinID: BAD80070
CyanoBase: syc1880_d
CYORF: syc1880_d
UniProt: O24704
Position
2024677..2025039
AA seq 120 aa
MKVSRRESTRRRHRRVRRTIVGTPARPRLSVFRSNNHIYAQVIDDAAGHTLAAASSLDPD
LRQSLTSGGNQQASAAVGKLIAERAQAKGVTTVVFDRGGNLYHGRVKALAEAAREAGLEF
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaaagtaagtcgtcgcgaatccacccgtcgcagacaccgccgtgttcgccgcacgatt
gtcggcacgccggctcgtccgcgtctctcggtatttcgctccaacaaccacatttacgcg
caagtgatcgacgatgctgcaggccacaccctggcagcagcatccagtctcgatcccgat
ctgcgccaatcattgacgtctggtggcaaccagcaagcttcggcagccgtaggcaaatta
attgccgaacgggctcaagccaagggcgttacgactgtcgtgttcgatcgcggcggcaac
ctttaccatggtcgcgtcaaggctttggccgaagcggctcgcgaagctggactggagttc
tag

DBGET integrated database retrieval system